KEGG   Bos taurus (cow): 788151
Entry
788151            CDS       T01008                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta01100  Metabolic pathways
bta01522  Endocrine resistance
bta04015  Rap1 signaling pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04062  Chemokine signaling pathway
bta04072  Phospholipase D signaling pathway
bta04114  Oocyte meiosis
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04371  Apelin signaling pathway
bta04540  Gap junction
bta04611  Platelet activation
bta04713  Circadian entrainment
bta04714  Thermogenesis
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04727  GABAergic synapse
bta04742  Taste transduction
bta04750  Inflammatory mediator regulation of TRP channels
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04913  Ovarian steroidogenesis
bta04914  Progesterone-mediated oocyte maturation
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04918  Thyroid hormone synthesis
bta04921  Oxytocin signaling pathway
bta04923  Regulation of lipolysis in adipocytes
bta04925  Aldosterone synthesis and secretion
bta04926  Relaxin signaling pathway
bta04927  Cortisol synthesis and secretion
bta04928  Parathyroid hormone synthesis, secretion and action
bta04934  Cushing syndrome
bta04935  Growth hormone synthesis, secretion and action
bta04970  Salivary secretion
bta04971  Gastric acid secretion
bta04972  Pancreatic secretion
bta04976  Bile secretion
bta05032  Morphine addiction
bta05163  Human cytomegalovirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05200  Pathways in cancer
bta05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    788151 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    788151 (ADCY4)
   04371 Apelin signaling pathway
    788151 (ADCY4)
   04020 Calcium signaling pathway
    788151 (ADCY4)
   04072 Phospholipase D signaling pathway
    788151 (ADCY4)
   04024 cAMP signaling pathway
    788151 (ADCY4)
   04022 cGMP-PKG signaling pathway
    788151 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    788151 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    788151 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    788151 (ADCY4)
   04062 Chemokine signaling pathway
    788151 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    788151 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    788151 (ADCY4)
   04912 GnRH signaling pathway
    788151 (ADCY4)
   04913 Ovarian steroidogenesis
    788151 (ADCY4)
   04915 Estrogen signaling pathway
    788151 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    788151 (ADCY4)
   04921 Oxytocin signaling pathway
    788151 (ADCY4)
   04926 Relaxin signaling pathway
    788151 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    788151 (ADCY4)
   04918 Thyroid hormone synthesis
    788151 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    788151 (ADCY4)
   04916 Melanogenesis
    788151 (ADCY4)
   04925 Aldosterone synthesis and secretion
    788151 (ADCY4)
   04927 Cortisol synthesis and secretion
    788151 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    788151 (ADCY4)
   04270 Vascular smooth muscle contraction
    788151 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    788151 (ADCY4)
   04971 Gastric acid secretion
    788151 (ADCY4)
   04972 Pancreatic secretion
    788151 (ADCY4)
   04976 Bile secretion
    788151 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    788151 (ADCY4)
   04727 GABAergic synapse
    788151 (ADCY4)
   04725 Cholinergic synapse
    788151 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    788151 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    788151 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    788151 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    788151 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    788151 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    788151 (ADCY4)
   04714 Thermogenesis
    788151 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    788151 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    788151 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    788151 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    788151 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    788151 (ADCY4)
   05163 Human cytomegalovirus infection
    788151 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    788151 (ADCY4)
Enzymes [BR:bta01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     788151 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 788151
NCBI-ProteinID: NP_001092678
Ensembl: ENSBTAG00000018419
VGNC: 25645
UniProt: A5PKE5
Position
10
AA seq 1073 aa
MARLFSPRQPPSEDLFYETYYSLSQQYPLLLLLLLIVLLGLLALLPVAWELAADPAFLTT
VLCALGGFSLLLVLASREQRLQRWTRPLSGLVWAALLALGHSFLFTGGVVSAWDQVSFFL
FVIFTVYAMLPLDMRDAITAGVTSSLSHLLVLGLYLGPQPDSRPALLPQLAANAVLFLCG
NAAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKEEIM
ARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGK
FDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDIN
MRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAGAYAV
EDAAMEHRDPYLRELGEPTYLVIDPWAAEEDEKGTAGGLLSSLEGSKMRPSLLMTRYLES
WGAAKPFAHLSHVESPVSTSTPLPEKALSSFSPQWSLDRSRTMRGPDEELDTGDAKFFQV
IEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPTFKYYAACTFLVFLSNFIIQML
VTNRPPALTITYGITFLLFFLLLFVCFSEHLMKCVLKGPKILHWLPTLSVLVATRPGLRV
ALGTATILLVFVMAITSLVFLPATSACPFQAPNMSSMASNLSWELPGSLPLISIPYSMHC
CVLGFLSCSLFLHMSFELKLLLLLLWLTASCSIFLHSHAWLSDCLIARLYLGTLDSRPGV
LKEPKLMGAVSFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLEN
VLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESSINHEGLECLRLLNE
IIADFDELLSKPKFSGVEKIKTICSTYMAATGLNATSGQDAQQDAEQSCGHLGTMVEFAV
ALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLG
KIQVTEETAWALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3222 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccacggcagccccccagcgaagacctcttctacgagacctac
tacagcttgagccagcagtacccactgctgctgctgctgctgctgatcgtgctcttgggg
ctcctggcgctgctccctgtggcctgggagctggccgcagacccagccttcctgaccact
gtgctgtgcgctctgggtggcttctcactgctgctggtcctggcttcccgggagcagcga
ctgcagcgctggacgcgtcccctgtcaggcctcgtgtgggcagcactgcttgcactaggc
cacagcttcctgttcactgggggcgtggtgagcgcctgggaccaggtgtcctttttcctt
tttgtcatcttcactgtgtatgccatgttgcccttggacatgcgggacgccatcaccgcg
ggtgtcacctcctcactctcacacttgctggtccttgggctgtatcttgggcctcagcct
gactctcggccggcgctgctgccacagctggctgcaaacgcggtgctgttcctgtgcggg
aacgcggccggagcctatcacaaggcgctgatggagcgcgcgctgcgcgccacgttccgg
gaggcgcttagttccctgcactcgcggcggagactggacaccgagaagaagcatcaggaa
caccttctcttgtccatccttcctgcctacctggcccgagagatgaaggaggagatcatg
gcacggctgcaggctggacaggggtcacggccagagagcaccaacaactttcacagcctc
tatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtgggcttcacgaga
ctggccagtgagtgctcccctaaggagttggtgcttatgctcaacgagctctttggcaag
ttcgaccaaatcgccaaggagcacgaatgcatgcggatcaagatcctaggagactgttac
tactgtgtctccggcctgccgctctcactgcctgaccacgccatcaactgtgtgcgcatg
gggctggacatgtgccgggccatcaggaaacttcgggcagccacaggcgtggatatcaac
atgcgtgtgggcgtgcactcaggcagcgtgctctgcggggtcatcgggctacagaaatgg
cagtatgatgtctggtcccatgacgtcactctggccaaccacatggaggcgagtggagtg
ccaggacgagtacatatcacaggggctacgctggccctgctggccggggcttatgctgtg
gaggatgcagccatggaacaccgggacccataccttcgggagctaggggagccgacctac
ctggtcatcgacccctgggctgcagaggaggacgagaagggtactgcaggagggttgctg
tcctctcttgagggctccaagatgcgtccatcactgctgatgacccgctacctggagtcc
tggggtgcagccaagcctttcgcccacctgagccacgtagagagccctgtgtccacatct
acccctctcccggagaaggccctgtcttccttcagcccccagtggagcctggaccggagc
cgtaccatgaggggacctgatgaggaactagacactggggatgccaagttcttccaggtc
atcgaacagctcaattctcagaaacaatggaaacagtcaaaggacttcaatccactgaca
ctgtacttcagagagaaggagatggagaaagagtatcggctctctgcactccccaccttc
aaatactatgcagcctgcaccttcctggtttttctctccaacttcattatccagatgctg
gtgacaaacaggcctccagctctgaccatcacctatggcatcaccttcctcctcttcttc
ctcctcctcttcgtctgcttctcagagcacctgatgaagtgtgtcttgaaaggccccaag
atactgcactggctacccaccctgtctgtcctggtggccacacggccaggactgcgagtg
gctctgggcaccgctaccatcctgctcgtcttcgtcatggccattaccagtctggtcttc
ttaccagcaacatcagcctgcccttttcaggctcccaatatgtcctccatggcttccaac
ctctcctgggagctccctgggtccctgcctctcatcagcatcccatactccatgcactgc
tgcgtgttgggcttcctctcctgctccctcttcctgcacatgagctttgagctgaagctg
ctgctgctcctgctgtggctgacggcctcctgctccatcttcctgcactcccacgcctgg
ttgtccgactgcctcatcgcccgcctctacctgggcaccttggactccaggccaggggtg
ctgaaggagcccaaactgatgggagcagtctccttcttcatcttcttcttcaccctccta
gtcctggctcggcagaacgaatattactgccgcctggactttctgtggaagaagaagctg
aggcaagagcaggaggagacagagacaatggagaacctgactcggctgctcttggagaac
gtgctccctgcgcacgtggccccccagttcattggtcagaatcggcgcaatgaggacctc
taccaccagtcctatgagtgtgtgtgtgtcctcttcgcctcggtcccagacttcaaggag
ttctactctgaatccagcatcaaccatgaggggctagagtgtctgcggctgctcaatgag
ataatcgctgattttgatgagctgctctccaagcccaagttcagtggggtggagaagatc
aaaactatctgcagcacctacatggcagctaccggcttgaacgccacctctggacaggat
gcacagcaggatgctgagcaaagctgcggccaccttggcaccatggtagagtttgctgtg
gcccttgggtctaagctggatgtcatcaacaagcactcattcaacaactttcgcttgcgt
gtagggttaaaccacggacctgtagtggctggagtgattggggcccagaaaccacaatat
gacatctggggcaacacggtgaatgtggccagccgcatggagagcacaggtgtcctgggc
aagattcaggtaacagaagagacagcctgggccctccagtccttaggctacacctgctac
agccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctacttcttgaacaca
gatttgacacgaactggacctccctcagccaccctaggctga

DBGET integrated database retrieval system