KEGG   Bos taurus (cow): 788250Help
Entry
788250            CDS       T01008                                 

Gene name
HIST1H3G
Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05202  Transcriptional misregulation in cancer
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    788250 (HIST1H3G)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    788250 (HIST1H3G)
  09165 Substance dependence
   05034 Alcoholism
    788250 (HIST1H3G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    788250 (HIST1H3G)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    788250 (HIST1H3G)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    788250 (HIST1H3G)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   788250 (HIST1H3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 788250
NCBI-ProteinID: XP_005223855
BGD-bta: BT27913
Ensembl: ENSBTAG00000031773
UniProt: P68432
Position
23
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcggactaagcagactgctcggaaatccactggcggcaaggccccgcgcaagcag
ctggccaccaaagcagcccgtaagagtgcgccggccaccggcggtgtgaagaagcctcac
cgctaccggcctggcaccgtggccctgcgcgagatccgccgctaccagaagtctacagag
ctgctgatccgcaagctaccgttccagcggctggtgcgcgagatcgcacaggacttcaag
accgacctgcgcttccagagctctgcggtgatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcaccatc
atgcccaaagacatccagcttgcccgccggatccgcggggagagggcgtaa

DBGET integrated database retrieval system