KEGG   Bos taurus (cow): 281768Help
Entry
281768            CDS       T01008                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 precursor
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04520  Adherens junction
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04714  Thermogenesis
bta04810  Regulation of actin cytoskeleton
bta04928  Parathyroid hormone synthesis, secretion and action
bta05200  Pathways in cancer
bta05205  Proteoglycans in cancer
bta05215  Prostate cancer
bta05218  Melanoma
bta05224  Breast cancer
bta05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    281768 (FGFR1)
   04015 Rap1 signaling pathway
    281768 (FGFR1)
   04010 MAPK signaling pathway
    281768 (FGFR1)
   04151 PI3K-Akt signaling pathway
    281768 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    281768 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    281768 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    281768 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    281768 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    281768 (FGFR1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    281768 (FGFR1)
   05230 Central carbon metabolism in cancer
    281768 (FGFR1)
   05205 Proteoglycans in cancer
    281768 (FGFR1)
  09162 Cancers: Specific types
   05218 Melanoma
    281768 (FGFR1)
   05215 Prostate cancer
    281768 (FGFR1)
   05224 Breast cancer
    281768 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    281768 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bta04090]
    281768 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    281768 (FGFR1)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     281768 (FGFR1)
Protein kinases [BR:bta01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   281768 (FGFR1)
CD molecules [BR:bta04090]
 Proteins
  281768 (FGFR1)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   281768 (FGFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_6 Ig_4 Pkinase_fungal Kinase-like DUF1615
Motif
Other DBs
NCBI-GeneID: 281768
NCBI-ProteinID: NP_001103677
BGD-bta: BT11580
Ensembl: ENSBTAG00000015457
VGNC: 50075
UniProt: A4IFL5
Position
27
AA seq 820 aa AA seqDB search
MWSRKCLLFWAVLVTATLCTAKPAPTLPEQAQPWGAPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLADSNRTRITGEEVEVRGSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSG
TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGP
DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEAL
EERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIP
LRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDRPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHHPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgtggagccggaagtgtctcctcttctgggccgtgctggtcacagccacgctctgcact
gccaagccggccccgaccttgccggagcaagcccagccctggggagcccctgtggaagtg
gagtccctcctggtccaccccggtgacctgctgcagctccgctgtcggctgcgggacgat
gttcagagcatcaactggctgcgggacggggtgcagctggcggacagcaaccgcacgcgc
atcaccggggaggaggtggaggttcggggctccgtgcccgccgactcaggcctctacgcc
tgcgtgaccagcagcccctccggcagtgacaccacctacttctccgtcaacgtctcagat
gcgctcccctcgtcggaggacgatgatgacgacgatgactcctcttcggaggagaaggaa
acagataacaccaaaccaaaccccgtggctccgtactggacgtcaccagaaaagatggaa
aagaaactgcacgcagtgccagctgccaagacagtgaagttcaaatgcccttccagtggg
accccgaaccccacactgcgctggctgaaaaacggcaaagaattcaagcccgaccacagg
atcggaggctacaaggtccgttatgccacctggagcatcattatggactccgtggtgcct
tcggataagggcaactacacctgcatcgtggagaacgaatacggcagcatcaaccatacc
taccagcttgatgttgtggagcggtcccctcaccggcccatcctgcaggcgggcttgcca
gccaacaagacggtggccctgggcagcaacgtggagttcatgtgcaaggtgtacagtgac
ccgcagccccacatccagtggctgaagcacattgaggtgaacgggagtaagattgggccg
gacaacctgccttatgtccagatcttgaagacggccggagttaacaccaccgacaaagag
atggaggtgctgcacttaaggaatgtctcctttgaggacgcgggggagtatacatgcttg
gcgggtaactctatcggactctcccatcactctgcatggctgaccgttctggaagccctg
gaagagagaccggcggtgatgacttcgccgctgtacctggagatcatcatctattgcacg
ggggccttcctcatctcctgcatggtggggtctgtcatcatctacaagatgaagagcggc
acaaagaagagtgacttccacagccagatggccgtgcacaagctggccaagagcatccct
ctgcgcagacaggtaacagtgtcggctgactccagcgcgtccatgaactccggggtcctg
ctagttcggccctcgcgtctctcctccagcggcacccctatgctggccggggtctctgaa
tatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggttttaggcaag
cccctgggagagggctgctttgggcaggtggtgctggcggaggccatcgggctggacaag
gacagacccaaccgtgtgaccaaagtggccgtgaagatgctgaagtcggatgcaacagag
aaagacctgtcggacctgatctccgagatggagatgatgaagatgattggaaaacacaag
aacatcatcaatctgctgggggcctgtacacaggatggtcccttgtatgtcatcgtggag
tacgcctccaagggcaatctccgagagtacctgcaggcccggaggccgccagggctggag
tactgctacaaccccagccaccaccccgaggagcagctctcctccaaggacctggtgtcc
tgcgcctaccaggtggcccgaggcatggagtatcttgcctccaagaagtgcatccaccgg
gacctggccgccaggaacgtcctggtgacggaggacaacgtgatgaagatcgcggacttc
ggtcttgctcgagacatccaccacatcgactactataaaaagacaaccaacggccgactg
cccgtcaaatggatggcaccggaggccttgtttgaccggatctacacccaccagagcgac
gtgtggtcttttggggtgctcctctgggaaatcttcactctgggcggctccccataccct
ggggtccccgtggaggagcttttcaagctgctgaaggagggtcatcgtatggacaagccc
agtaactgcaccaacgagctctacatgatgatgagagattgctggcacgcggtcccctct
cagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttgacctcc
aaccaggagtacctggacctgtcaatgcccctggaccaatactcccccagcttccccgac
acccgcagctccacctgctcctccggggaggattccgtcttttctcacgagcccttgccc
gaggaaccctgcctgccccgacacccggcccagctggccaacggcggactcaaacggcgc
tga

DBGET integrated database retrieval system