KEGG   Bos taurus (cow): 327714Help
Entry
327714            CDS       T01008                                 

Gene name
NDUFA5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
bta  Bos taurus (cow)
Pathway
bta00190  Oxidative phosphorylation
bta01100  Metabolic pathways
bta04714  Thermogenesis
bta04723  Retrograde endocannabinoid signaling
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer disease
bta05012  Parkinson disease
bta05016  Huntington disease
Module
bta_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    327714 (NDUFA5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    327714 (NDUFA5)
  09159 Environmental adaptation
   04714 Thermogenesis
    327714 (NDUFA5)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    327714 (NDUFA5)
   05012 Parkinson disease
    327714 (NDUFA5)
   05016 Huntington disease
    327714 (NDUFA5)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    327714 (NDUFA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETC_C1_NDUFA5
Motif
Other DBs
NCBI-GeneID: 327714
NCBI-ProteinID: NP_787023
Ensembl: ENSBTAG00000009334
VGNC: 31949
UniProt: P23935
Structure
PDB: 

Position
4
AA seq 116 aa AA seqDB search
MAGLLKKTTGLVGLAVCETPHERLKILYTKILDVLGHIPKNAAYRKYTEQITNEKLSMVK
AEPDVKKLEERLQGGQIEEVILQAENELSLARKMIQWKPWEPLVEEPPASQWKWPI
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcttgctgaagaagaccactggcctggtgggattggctgtttgtgaaactcca
catgagaggctaaaaatattgtatacaaaaattcttgatgttcttggacacatccctaaa
aatgcagcatatagaaagtatacagaacagattacaaatgagaagctgagtatggttaaa
gcggaacctgatgttaaaaaactagaagagcgactgcagggtggccaaatagaagaggtt
attcttcaggctgaaaacgaactaagtctggcaagaaaaatgatccagtggaaaccatgg
gagcctttagtggaagagcctccagccagccaatggaaatggccaatataa

DBGET integrated database retrieval system