KEGG   Bemisia tabaci (sweet potato whitefly): 109034579Help
Entry
109034579         CDS       T06019                                 

Definition
(RefSeq) autophagy-related protein 16-1
  KO
K17890  autophagy-related protein 16-1
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab04136  Autophagy - other
btab04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:btab00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109034579
   04136 Autophagy - other
    109034579
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:btab04131]
    109034579
   03029 Mitochondrial biogenesis [BR:btab03029]
    109034579
Membrane trafficking [BR:btab04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    109034579
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    109034579
Mitochondrial biogenesis [BR:btab03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    109034579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A FAM76 CVNH FUSC V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 109034579
NCBI-ProteinID: XP_018903350
Position
Unknown
AA seq 549 aa AA seqDB search
MSWRDDIVAKIQNRNREQVSSFEELIVTHNRLFENFLALKSENVQLSVLNEKLRVGSFEQ
SKAGSSGGGDAAFTERILTLEQKLLSQQEELTELHKRRGENAQMLVDLNATLQEKEKLLA
SKDESLLQNDKTIASLRAEIEMYKKSRKELEDMNQVLKDEYQALHLAFTHLEEKLRKVQD
ENREMVERLMKYKTKDAEKMNEENENFIRKKQIKLQKELEDAAKDTLGFTPDNLFKDMLP
PPIQAVAGVPTKPSIVFTAHNGEVNAIKFSPVDKVIATGGADRLVKLWDISKGIQESRGV
MQGSNKGVMSVEYDTTGGLILGASNDHASRVWTTSDMRLRHCLTGHSGKVLAAKFLGEAT
KVATGSHDRVLKIWDLRSRACVETKFAGSCCNDLVPADSSGTTIISGHFDKKIRFWDTRT
ESANKEIEVQGKVTSLDLSRDFKYLLASVRDDTLKVIDLRTYQILSTFSADGFKVACDYT
RAVFNGDCNYVSCGSAEGAVYVWDVLSTKLEVVLPDAHKNAVTAVAWCPITNYLASVDRS
GQVVIWADT
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcgagatgatattgttgctaaaatacaaaataggaaccgagagcaagtctct
agtttcgaggaactgatagtcacacataatcgcctttttgagaatttcctggccctgaaa
agtgaaaatgttcaattatcagttttgaatgaaaaactgcgtgttggtagctttgaacaa
tcaaaagccggatcatctggaggtggagatgctgcattcacagaaagaattcttactctc
gaacagaaacttctaagccagcaggaggagctcaccgagttgcacaaacggcgtggtgaa
aatgctcaaatgctggtggatctgaatgccactcttcaagaaaaagaaaaactacttgct
tcgaaggacgaaagtttgctgcaaaatgacaagactatagcaagtttgcgagcagaaatt
gaaatgtacaaaaaaagccgtaaagagcttgaagacatgaatcaagttttgaaggatgaa
tatcaagccttacacctagcttttactcatcttgaagaaaaactacgtaaagtacaggat
gaaaacagagaaatggtggagaggcttatgaagtacaaaactaaagatgctgaaaaaatg
aacgaggaaaatgaaaacttcatcagaaaaaaacaaatcaaactccaaaaagaactagaa
gatgctgcaaaagatactctagggtttacacctgataatctcttcaaagatatgctgcca
cctcctattcaagcagtcgctggtgtacccaccaaaccgtccattgtgttcactgctcac
aatggagaagtgaatgccatcaaatttagccctgtggacaaagtcatcgccactggtggt
gcagatagattggtgaagctatgggatatctcgaaaggtatccaagagagtaggggggtt
atgcagggtagcaacaaaggagttatgtccgttgaatatgataccactggaggcctaatc
ttaggagcatcaaatgatcatgcatcccgtgtatggactacaagcgacatgcgattaagg
cattgtttgaccggccactcaggaaaagttttagctgctaaatttctaggagaggccact
aaagtagcaacagggagccatgatagagttctcaaaatctgggaccttagaagtagagcc
tgcgtggaaacgaagtttgccggctcttgttgtaatgatctagttccagccgacagctct
ggcactaccatcattagtggtcattttgacaagaaaattagattttgggacacaagaaca
gaatctgccaataaagaaatagaagtacaaggaaaagttacctctctagatttatctcgt
gattttaaatacttactcgccagtgtccgagatgacacccttaaagtaattgacttacgc
acttatcaaatcctatccacttttagtgcggacgggtttaaagtagcatgtgattatact
cgtgcagtattcaatggagactgtaactatgtttcttgtgggtctgcagaaggtgctgtc
tacgtttgggatgtactgagcacaaaattagaagtagttttaccagatgcacacaagaat
gcagtgacggccgtcgcatggtgtcctattacaaattatctagctagtgtcgatcgctct
ggtcaagttgtaatttgggcagatacttag

DBGET integrated database retrieval system