KEGG   Bemisia tabaci (sweet potato whitefly): 109034972Help
Entry
109034972         CDS       T06019                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab00601  Glycosphingolipid biosynthesis - lacto and neolacto series
btab00603  Glycosphingolipid biosynthesis - globo and isoglobo series
btab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    109034972
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    109034972
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:btab01003]
    109034972
Enzymes [BR:btab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     109034972
Glycosyltransferases [BR:btab01003]
 Glycan extension
  P blood group
   109034972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 109034972
NCBI-ProteinID: XP_018903964
Position
Unknown
AA seq 362 aa AA seqDB search
MHAFQTSQKHVISNFLGSKLRHKKIICILFLFLFILFCTWDQLIFSLYVYKVPTGLNCYK
DQQKDLAVLTVPDYKVPPNSIFFVETSCRHDEGIDISKRQACAYESAAKVHPDSEILVLF
PSPISLGTQSTLVTELLKYPNIKLVHIDMEKYFSDTPLEDFYKQGKLEKSYWPKSHASDA
LRYLTLWRYGGTYLDSDIVMIRPINTMENFAGAESKTDIAAGFLNFNISGVNGRQLADEM
IHEIKNNFRGWDWGYNGPGVVSRVLRRICNEENVLRMTPEKCKGFTVFPPSAFYPISWRN
WRMYFNEHVSQMFLDQLGESFGIHVWNMHSSKTPVKVGSRMPYSVFASKFCPRVYSVVGD
YL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttttcaaacatcgcaaaagcatgttatctcaaactttcttggaagtaaactg
aggcacaagaaaatcatatgcattttattcctgttcctatttattcttttttgcacatgg
gaccagctgatattttccctttacgtctacaaagtgccaacaggcctgaattgttacaaa
gaccaacagaaagatttagctgttcttacggtccctgattataaagttccaccaaacagt
attttttttgttgaaacatcatgtcgacatgatgaaggcatcgacatctctaaaagacaa
gcctgtgcctatgaatcagctgccaaagttcacccagactctgaaatcttggtgttattt
ccgtctccgatttctctgggcacccagtcaacgctcgtcactgaattgttgaagtatccc
aacataaaattggtgcacattgacatggagaagtatttttcagatacgcctctagaagat
ttttacaagcaaggcaagttagagaagagctactggccaaaatctcatgcaagtgatgct
ctaagatatttgacgttatggagatatggcggcacgtacttggactcggatattgttatg
attaggcctatcaatacaatggaaaattttgcgggtgcagaatcaaagacagacattgct
gctggttttttgaattttaatatcagtggcgtcaatggaagacagcttgctgatgaaatg
atccacgaaatcaagaacaattttcgtggctgggattggggttacaatggaccaggagtt
gtttctagagtcttacgcaggatttgtaatgaagaaaatgttctgcggatgactcctgag
aagtgtaaaggctttaccgtgttcccaccctctgcattttatcccatctcttggcgtaac
tggaggatgtatttcaacgagcacgtgagtcaaatgtttcttgaccaacttggcgagagt
tttggaattcatgtgtggaatatgcacagcagcaaaactcccgtcaaagtcgggtcgcgg
atgccttatagtgtgtttgcctctaaattttgtccgagagtatattcagttgttggtgat
tatttgtaa

DBGET integrated database retrieval system