KEGG   Bemisia tabaci (sweet potato whitefly): 109039835Help
Entry
109039835         CDS       T06019                                 

Definition
(RefSeq) heat shock protein 70 B2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab03040  Spliceosome
btab04141  Protein processing in endoplasmic reticulum
btab04144  Endocytosis
btab04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:btab00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109039835
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109039835
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109039835
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109039835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:btab01009]
    109039835
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:btab03041]
    109039835
   03009 Ribosome biogenesis [BR:btab03009]
    109039835
   03110 Chaperones and folding catalysts [BR:btab03110]
    109039835
   04131 Membrane trafficking [BR:btab04131]
    109039835
   03051 Proteasome [BR:btab03051]
    109039835
   03029 Mitochondrial biogenesis [BR:btab03029]
    109039835
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btab04147]
    109039835
Protein phosphatases and associated proteins [BR:btab01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109039835
Spliceosome [BR:btab03041]
 Complex B
  Other components
   Prp19 complex
    109039835
 Complex C
   Prp19-CDC5 complex
    109039835
Ribosome biogenesis [BR:btab03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109039835
Chaperones and folding catalysts [BR:btab03110]
 Heat shock proteins
  HSP70 / DNAK
   109039835
Membrane trafficking [BR:btab04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109039835
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109039835
Proteasome [BR:btab03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109039835
Mitochondrial biogenesis [BR:btab03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109039835
Exosome [BR:btab04147]
 Exosomal proteins
  Proteins found in most exosomes
   109039835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA Hydantoinase_A Aerolysin ACCA
Motif
Other DBs
NCBI-GeneID: 109039835
NCBI-ProteinID: XP_018911047
Position
Unknown
AA seq 615 aa AA seqDB search
MEKRAIGIDLGTTHSCVCVWQNGKMEVISNEQGNRVTPSYVAFSEVRLIGDTAKMLAPIN
PKNTIFDVKRLIGRKFDDPLVQADMKHWPFTVINDAGNPKVSVEYQGVDKVFAPEEISSM
VLSKLKETAEVYLNRKVTDAVITVPAYFNDSQRQATKDAGAIAGLNVLQIINEPTSAAIA
YGLDQNLKSKRNILVFDLGGGTFDVSVLTVDEGSLFEVKSTAGDSHLGGEDFDSLLMNYL
IEEFKLKHSKDLASNPRALSRLRAAAERAKCTLSSAPTANIMIDSLFDGIDFYTQVTRPK
FEDLCADLFQRTLTTVEQALTDAKIEREAIDDVVLVGGSTRIPKVQLLLQNFFDGKTLNH
SIHPDEAVAYGAAVQAASLSGNEDLEIKDIVLRDVTPLSLGVFTKNDIFSVIIQRNTRIP
CKIRREFVTVGDNQESVAIHIYEGERTVATENHLLGKVLLQGIKRAPKGVTKVDVSFDLN
EEGILSVSVEEKGTNKSEQITITNEKGRLSKGDIRRMIKEAKSFKEKDEKHLARSRARNQ
LEDYTYKMMQDFKVAESQLSQADKSSMKEESDKIWDWLKKNPKAGLGQYKRKLQDIQEKC
QPIMKKIHKEDALLD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacgagcgatcggaattgatttgggaaccacccattcctgtgtctgtgtctgg
cagaatggtaaaatggaagtaataagcaatgaacaaggtaatcgagtaacacccagctac
gttgccttttcagaagtacgattgattggagatactgccaaaatgctagctcctatcaac
ccgaagaacaccatatttgatgtgaaacgtctcataggtcgcaaatttgatgatcctcta
gtgcaggctgatatgaagcattggccctttactgtaatcaacgatgctgggaatcctaaa
gtgagtgttgagtaccaaggagtggataaggtatttgcgcctgaggaaattagttccatg
gtcctgtcaaaattaaaagaaacagctgaagtctacctaaacagaaaagtcactgatgct
gtaattactgttccagcatatttcaatgactctcaaagacaggccacaaaagatgctgga
gctattgcagggttgaatgtcttgcaaatcattaatgagcccacttcagctgccattgca
tatggactagatcaaaacttgaagagcaagcggaacatcctggtttttgatttgggcggc
ggtacttttgatgtttctgtcctgacggtcgatgaaggttctttatttgaagtgaaatcg
actgctggtgactctcatttgggtggtgaagactttgacagccttctgatgaactatttg
atcgaagaattcaagctgaagcacagcaaagatcttgcatccaaccctcgagcactaagt
agattgagggctgctgcagagcgagccaaatgtaccttgtcatcagcaccaacagccaac
atcatgattgatagtttatttgacggtattgatttttacacacaagtcacaagacctaag
tttgaagacctttgtgctgatttgttccaaagaacattgaccacagtcgagcaagcttta
acagatgctaaaatagaaagagaagcaattgatgatgtagttcttgttggaggttccacg
agaattccaaaggtccaattattgctccagaatttctttgatggtaaaaccttgaatcac
tcgattcacccagatgaggctgttgcttatggtgctgccgtgcaagctgcttcactgagt
ggaaatgaagacttagaaattaaggatatagtgttgcgcgacgttactcctctttccctt
ggtgttttcaccaaaaacgacatattcagtgttatcattcagagaaataccaggattcca
tgtaaaataagaagagaatttgttaccgtaggggataaccaggaatcagtggccattcat
atctatgaaggtgagcgcacagtagccactgagaatcatttgctgggtaaggttttactg
caaggtatcaaaagagcacccaaaggtgtgactaaggtagatgtctcgtttgacttgaat
gaagagggaatcctttcggtttcagttgaagaaaaaggcactaacaaatctgaacaaatt
acgatcactaatgaaaagggtcgcttatccaaaggagacatcagacgaatgatcaaagag
gctaaaagttttaaagaaaaagatgagaagcatttagctcgatccagagctaggaatcaa
ctagaggattatacttacaaaatgatgcaggactttaaagtagcagaatctcagctcagc
caggctgataagagcagcatgaaagaggaaagcgataaaatctgggattggctgaagaaa
aatcctaaagctggtctaggacaatataaacggaagttgcaagatatccaggagaagtgc
cagccgatcatgaagaaaattcacaaagaagatgcgctacttgattaa

DBGET integrated database retrieval system