KEGG   Bemisia tabaci (sweet potato whitefly): 109040059Help
Entry
109040059         CDS       T06019                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like isoform X1
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab04013  MAPK signaling pathway - fly
btab04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:btab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109040059
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109040059
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:btab01009]
    109040059
Enzymes [BR:btab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109040059
    3.1.3.48  protein-tyrosine-phosphatase
     109040059
Protein phosphatases and associated proteins [BR:btab01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    109040059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase PTPlike_phytase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 109040059
NCBI-ProteinID: XP_018911381
Position
Unknown
AA seq 539 aa AA seqDB search
MSVSSGKGGGDGDCQGPERNPHPAVAAAAAAGSRASGSDIPAESPEESCEMTSVLATRSL
DDFKNVSEDGWRYKPEGSYLPPVGASRKRSLSSLLQQKCAGAGSGAMSTVYCEVEVGKSR
EGLRLSLNRSLSEPGPAAAAPLPAAAAPAKRCKVDCFSLPASPCSESATLQKALLAKCVR
LFEPETLAGRLGLGQVKSRSLLVVDCRPFLAYNVNHIRGSINVNCSDRFNRRRLQQGKAT
LADLATTREGKDLLKKRTIKEVVVYDDSTSDLERLPPNHPLFLVLSSLVEDNREPAILLG
GHKEFVKKHKEFCEDALLPPGDPASSPSASSRCQWEILGSPTTAAALDSRCASDIESHPA
SRVLPHLYLGNQRDAENLDVLRNLGISRVLNVTSELPGYHEERGILYKHLPAADSSHQNL
KQYFEEAFHFIEEARQSGGSVLVHCQAGISRSPTIAIAYMMKHRRLSLIEAYKEVKNART
IISPNFNFMGQLFELEQSLKATPVSSDSQSDSCTPAPAPCHPCRWSPQANEEVSSGCSV
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgtcttccggaaaaggcggcggtgacggcgattgccaaggacccgaacgaaat
cctcacccagcggtagcggcagcggcggcggcgggcagtcgcgcgtcgggttccgatatt
ccagctgagtcacccgaggaatcgtgcgaaatgacgagcgttttagcaaccagatcccta
gatgatttcaagaacgtatccgaagatggttggcgttacaaaccggaaggatcgtatcta
ccaccagtgggagcttccagaaaacgatctttatcttcacttttacagcaaaaatgtgcg
ggagcgggaagcggggcgatgtcgacggtgtactgcgaggtggaggtgggcaagtcgcgg
gaggggctccggctctcgctgaaccggagcctgagcgagccggggccggcggcggcggcg
cccctcccggccgcggcggcccccgccaagcgctgcaaggtggactgcttctccctcccg
gcgagcccgtgctccgagagcgccaccctccagaaggccctcctcgccaagtgcgtgcgc
ctcttcgagccggagaccctggccgggcgcctcgggctcgggcaggtcaagtcccggagc
ctcctcgtcgtcgactgccgccccttcctggcctacaacgtcaaccacatccgcggctcc
atcaacgtcaactgctcggaccgcttcaaccggcgccggctccagcagggcaaggccacc
ctcgccgacctggccaccacccgcgaggggaaggatcttctgaagaagcgcaccatcaag
gaagtggtcgtctacgacgattccacctccgacctggagcgcctcccacccaaccacccc
ctctttctcgtgctatcgtcgctcgttgaggacaaccgggaaccggctattcttctaggt
ggccacaaagagtttgtgaagaagcacaaggagttctgcgaggacgcgctcctgccgccc
ggggacccggcctcgtcgccgtcggcgtcgtcgcggtgccagtgggagatcctgggctcc
ccgacgacggcggcggccctggactcgcgctgcgcctccgacatcgagtcgcaccccgcc
tcgcgggtcctcccccacctgtacctgggcaaccagcgggacgccgagaacctggacgtc
ctccgcaacctgggcatctcccgagtcctcaacgtcacctccgagctccccggctaccac
gaggagcggggcatcctctacaagcacctccccgccgccgactccagccaccagaacctc
aagcagtacttcgaagaagcattccactttatcgaggaagccaggcagagcggtggaagc
gtcctggttcactgccaagcagggatctcgcgttcgccgacgatcgccatcgcttacatg
atgaagcaccgcaggctcagcttgatcgaggcttacaaagaggtgaaaaacgccagaacg
atcatatcccccaacttcaacttcatgggacagctcttcgagctggagcaaagtctgaaa
gcaactccagtctcgagcgattcacagtctgattcctgtactcccgccccggctccttgt
catccctgcagatggagtccccaggccaacgaggaagtgtcctctggatgcagcgtctaa

DBGET integrated database retrieval system