KEGG   Bemisia tabaci (sweet potato whitefly): 109040643Help
Entry
109040643         CDS       T06019                                 

Definition
(RefSeq) uncharacterized protein LOC109040643
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab00480  Glutathione metabolism
btab00980  Metabolism of xenobiotics by cytochrome P450
btab00982  Drug metabolism - cytochrome P450
btab00983  Drug metabolism - other enzymes
btab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109040643
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109040643
   00982 Drug metabolism - cytochrome P450
    109040643
   00983 Drug metabolism - other enzymes
    109040643
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btab02000]
    109040643
Enzymes [BR:btab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109040643
Transporters [BR:btab02000]
 Other transporters
  Pores ion channels [TC:1]
   109040643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_5
Motif
Other DBs
NCBI-GeneID: 109040643
NCBI-ProteinID: XP_018912175
Position
Unknown
AA seq 440 aa AA seqDB search
MTIDLYHISLSSPCRAVRLAAKLIGVDLNLKVINIFEWEHLTPEFLKMNPQHTIPVLDDN
GFYLTESRAIMTYLASKYGTDYSLYPKDVQKKAIVDQRLFFDMEIIFQPFKDYFLPLVLK
KGHDEVKFQEIPRNLPFLEKILENSEFVAGGSITIADVALVTTVSNYEVVGVDLTKFPNI
HRWYTTCQKILPGYDEINLKGAIELKELWEDLKSKGKSEDMTIDLYFHPASAPCRGVLLA
AKLIGVDLNIKHTNVAKGENMTPHFLKMNPQHTIPTLDDNGFYLWESRAIITYLFNKYGK
DDSLYPQDPKKRAIVDQRFYFDMGTLLQRYIDYFYPSTFFGAPADLDKLRKLEEAFGFLD
VMLEGSIYAAGDSITLADASLAASVSTVDIVGIIDLKKYPNVNRWFTACKRTLPDYEEAN
AEGAALFKQLVDQYAVRKLQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgacttgtatcatatttcattaagttccccatgccgtgcagtcagattagct
gcaaagctaatcggggtggacttaaacctcaaggttatcaatatctttgaatgggaacac
ttgactccagaatttttgaagatgaatcctcaacacacgatccctgttctggatgacaat
ggattttacttgacggaaagtcgtgccattatgacgtatttagccagcaaatatggaaca
gattattctttgtatccaaaggatgttcagaagaaagctatcgtggatcagagacttttc
tttgatatggaaataatatttcagcccttcaaagattattttttaccactggttttgaaa
aaaggccatgacgaggtgaaatttcaagaaattcctaggaatctaccctttcttgaaaaa
atacttgagaactcagaattcgtagcagggggttctattacaatagctgatgttgcactc
gtcactactgtttctaattatgaggtggttggtgttgacctcaccaagtttccaaatatt
caccggtggtatactacgtgccaaaaaatactaccgggttatgacgaaattaatctgaaa
ggagccattgaattaaaagagctttgggaagatttaaagtcaaaagggaaatctgaagac
atgacgatcgatttgtacttccacccagcgagtgcaccttgccgcggtgttttgctggcg
gcaaagttaatcggtgttgacctcaacattaagcatacaaacgtggctaagggtgaaaat
atgacaccacacttcctgaagatgaatcctcaacacacaatcccaacgttggatgacaat
gggttctacctgtgggaaagccgtgcaataattacctatctgttcaacaagtacggtaaa
gatgactcgttgtaccctcaagaccctaaaaaacgagcaatcgttgaccaaagattctat
tttgacatgggtacccttttgcaacggtacatcgactatttttaccccagcactttcttc
ggagctcctgctgatctggataagctgagaaaattggaggaggcatttggatttttggat
gtaatgctggagggatctatatacgcagcaggggactcaatcacgttggcagatgcgtct
ctcgcagcctcggtctcaacagtcgatattgtcggtataatagatcttaaaaaatacccg
aatgtcaatagatggtttacggcatgcaagagaactctaccagattacgaggaagctaac
gccgagggtgctgctctcttcaaacagttggtggatcagtatgcagttcgaaaattgcaa
taa

DBGET integrated database retrieval system