KEGG   Bemisia tabaci (sweet potato whitefly): 109042467Help
Entry
109042467         CDS       T06019                                 

Definition
(RefSeq) septin-7 isoform X1
  KO
K16944  septin 7
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Brite
KEGG Orthology (KO) [BR:btab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:btab04131]
    109042467
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:btab04812]
    109042467
   04147 Exosome [BR:btab04147]
    109042467
Membrane trafficking [BR:btab04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    109042467
Cytoskeleton proteins [BR:btab04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     109042467
Exosome [BR:btab04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109042467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 AIG1 RsgA_GTPase ABC_tran AAA_29 AAA_16 Ras AAA_22 Kinesin FeoB_N
Motif
Other DBs
NCBI-GeneID: 109042467
NCBI-ProteinID: XP_018914774
Position
Unknown
AA seq 622 aa AA seqDB search
MSSVSGNGVPSGGSGSASLKVGSKVGMGLGKPVPPPTIPQTYGSTSPYRISSLDKLAQRY
NNLSGTTLNGSSLGSTAKDKEPSAALNGTSSSDSLLLSKRELFFKNETASPGATATSNGP
SNPPPAVPNSAPPTGPPAPPTATSLKESLSKRIAERVNAEAAASENGTENKEKYNKLEKD
KTVPERKLKELDGYVGFANLPNQVYRKAVKKGFEFTIMLVGESGLGKSTLLNSMFLADIY
GPEYPGPSHRIKKTIMVETQRCLLKENGVNLVLTVVDTPGFGDAVDNSNCWQPVIEFVES
RYDEFLNSESRVNRKPQPDTRVHCCLYFIAPSGHGLKPLDVEFMQRLHEKVNIIPIIAKA
DTLTPDECTQFKKQILNEIAQHKIKIYEFPETDDDEDAKQNKILRDRVPFAIVGSNTVIE
VNGKKVRGRKYPWGIAEVENLEHNDFIALRNMLLRTHLQDLKDVTNNVHYENFRCRKLAV
LGPDGKQGQGFNIFCPQGVIDNTFMTVWNPLAQLEEEKREHDIRIKKLEVEMEQVFEMKV
REKKQKVKDSELDLQKRHEQMRKNLEQQIRELEDKKNALKAEILDWENMNGVKLDDLRRR
SLERDQGDGKEKKSKKKGLFHS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgttagtgggaacggggtgccctcggggggctcggggtcagcctcgctcaaa
gtggggtcgaaagtggggatgggtctgggcaagccggtgccccctccgacgatcccacaa
acttacggaagcacatccccgtaccggatttcttctttggacaagctcgctcagcgctac
aacaacctctccggcacgaccctgaacggatctagtctcggttccaccgccaaggataag
gaacccagcgccgcccttaacggaacatcaagctctgattcactgttgctctcgaagcgg
gagctttttttcaaaaacgagacggcgtcgccaggggccacggctacgagcaatgggccc
tcgaaccccccgcccgcggtccccaactcggcgcccccgacgggaccccccgcgcccccc
accgctacctccctgaaggagtccctctcgaaaaggatcgccgaaagagtcaacgcagaa
gcagcagcatcagaaaatggtaccgagaacaaagagaagtacaataaattggaaaaggat
aaaactgtacctgagcggaaactgaaggagttagatggttatgtaggttttgccaatctc
ccaaatcaagtttaccgaaaagctgtcaaaaaaggtttcgagttcaccattatgttagta
ggtgaatccggtcttggaaagtcaacgttgctcaactcaatgttcctagcggatatttat
ggtccagagtatccaggtccatcgcataggattaagaaaacaataatggttgaaacacag
agatgtttgctgaaagaaaatggagtgaatctcgtcctcactgtggtagatacaccaggt
tttggtgatgctgttgacaactctaactgttggcaacctgttattgaatttgttgaatca
aggtatgatgaattcctcaactcagaatctcgggtaaaccggaaaccacagcctgacacg
agggtacactgctgtctctacttcattgcaccctcaggacatggtcttaaacctttagat
gtagaattcatgcagagactgcatgaaaaagtaaatattattcctatcattgccaaagct
gacacgcttacgcccgatgaatgtacacaattcaaaaaacaaattttaaatgaaatagcg
caacataaaatcaaaatatatgagtttccagaaacagatgacgacgaagatgccaaacaa
aacaaaattctgcgagatcgtgttccttttgcaatagttggttccaatacagtgatagaa
gtcaatggaaagaaagtccggggtaggaagtatccttggggaatcgcagaagtggaaaat
ttagagcacaatgatttcattgccctacgaaatatgttactacgcacacatttacaagat
ttgaaagatgtgacaaataatgttcattatgaaaacttcaggtgtcgtaaattggcagtt
cttggcccagatggcaaacaaggacaaggtttcaacattttctgcccgcaaggagtcatt
gacaacactttcatgactgtttggaacccgcttgctcaattagaggaggagaaacgtgaa
cacgacattcgaatcaagaaactggaagtagagatggagcaagtctttgaaatgaaagtt
cgagaaaagaaacaaaaagttaaggactcagaacttgatcttcaaaaacggcatgaacaa
atgcgcaaaaatttggagcaacaaattagagaactagaagataaaaagaatgctctaaaa
gcagaaatactagactgggagaatatgaatggtgtaaaattggacgacctcaggcgtaga
agtcttgaaagagatcaaggggacggtaaagagaaaaaatcaaagaagaaaggcctcttc
cattcgtaa

DBGET integrated database retrieval system