KEGG   Bemisia tabaci (sweet potato whitefly): 109042799Help
Entry
109042799         CDS       T06019                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab00051  Fructose and mannose metabolism
btab00520  Amino sugar and nucleotide sugar metabolism
btab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    109042799
   00520 Amino sugar and nucleotide sugar metabolism
    109042799
Enzymes [BR:btab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     109042799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 109042799
NCBI-ProteinID: XP_018915270
Position
Unknown
AA seq 427 aa AA seqDB search
MDKSMVKAIILIGGPQKGTRFRPLSLDTPKPLFPVAGLPMIQHHIEACTRINNLKEIIIL
GYYPTNDLAQFVSEMNQKYKILIRYLQEFTPLGTAGGMYHFRDQVRSGNPSGFFVIHGDV
CSDFPLSQMLEFHEKRPGALITVLGTEATKQQSVYYGCLVCAKETSEITHYVEKPSTFVS
TLINCGVYFCSIDIFQIMADVFKKKEEAFYNGENGYGSENGCSGSMQLEKEVLQPLSGTG
KSFVYQITDWWSQLKSAGSAIYANRHYLQVYRNKHPERLAKSKENQVNIIGDVYIHPSAT
VHPSAILGPNVSISAFATVGPGVRIRESIVLQEAVIADHSLILYSIVGRGTKVGEWTRVE
GTPCDPNPNKPFAKMDNLPLFNSSGKLNPSITVLGCSVTVPSEVILLNSIVLPYKDLTRS
FKNEIIL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggataaaagcatggtaaaagcaatcatactcatcggtggtccacaaaaaggcactcgt
tttcggcctttgtctttggatactccaaagcctctgtttcctgttgccggactaccaatg
attcagcatcatattgaggcatgcacacggatcaataatctgaaagaaatcatcatacta
ggatactatcccactaatgatcttgcgcagtttgttagtgaaatgaatcaaaaatataag
attttaattaggtacttacaggaattcacccctcttggaacagcgggtggaatgtatcat
ttcagggatcaagttagaagtggaaatcctagtggcttctttgttatacatggcgatgta
tgttccgacttccctttgagtcaaatgctcgaattccatgaaaaacgacctggagctcta
atcacagttctaggaacagaggcaacaaagcaacaatctgtatattatggttgcctcgtt
tgtgccaaagaaacttcagaaataacacactatgttgagaaaccctcaacctttgtttca
actctaataaactgtggtgtgtacttttgttcaattgatattttccaaattatggcagac
gttttcaagaaaaaagaagaagctttttataatggagaaaatggatacggatctgaaaat
ggttgcagtggtagcatgcagttagaaaaagaagtattgcagccactctctggtactggg
aagtcatttgtctaccaaatcactgattggtggtctcagttaaagtcagctggttcagca
atttatgctaatcgccactatcttcaagtttatcggaacaaacatcctgagcgacttgca
aaatcaaaggagaatcaagtgaacattatcggtgatgtgtatattcatccaagtgcaact
gttcatccttcagccattcttggaccaaatgtatcaattagtgcctttgctactgttggg
cctggggtgcgcataagggaatcaatagtccttcaagaagcggtcattgctgaccacagt
ttaattttatatagcatcgtgggtcgaggaactaaagttggcgagtggactcgtgttgaa
ggaactccttgtgatcctaatccaaacaagccgtttgccaaaatggataatctgcctttg
ttcaattcaagcgggaaattgaatccttcaataacagttcttggttgcagtgtcacagtg
ccctcggaggtgatcttgctaaattcaattgttcttccctataaagacttgacgagaagt
ttcaaaaatgagatcattctttga

DBGET integrated database retrieval system