KEGG   Bacillus thuringiensis BMB171: BMB171_C0425Help
Entry
BMB171_C0425      CDS       T01239                                 

Gene name
glsA1
Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00220  Arginine biosynthesis
btb00250  Alanine, aspartate and glutamate metabolism
btb00471  D-Glutamine and D-glutamate metabolism
btb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMB171_C0425 (glsA1)
   00220 Arginine biosynthesis
    BMB171_C0425 (glsA1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BMB171_C0425 (glsA1)
Enzymes [BR:btb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BMB171_C0425 (glsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase TIMELESS
Motif
Other DBs
NCBI-ProteinID: ADH05243
Position
complement(489028..489957)
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKETEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVADSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKKKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGDMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgaaacaaacaacttacaacagttgttagaacaagtaaaaccatataca
aaaaaaggaaaacttgctacttatatccccgaactaggaaatgcaaatccagacgattta
gggattgccattttccataaagaaacagaatatatccatgcaggcaactcacaaacacta
tttactcttcaaagtatttccaaagtaattacacttgcccttgcccttttagaccgtggt
gaagaatatgtattttctaaagttggaatggaaccaacgggtgacccatttaattctatt
attaagttagaaacgacaagtccgtccaaaccccttaatccaatgataaatgcaggagca
ttagctattacaagcatgttagcaggaaaagataacgaggaaaaaatggaacgtattctt
cattttgtacgtgaaataacagataatcctactattaattattcctctaaagttgccgat
tcagaactagagacagcttacctaaaccgttcactttgttattatatgaaacaaaacgga
attatcgattgtgatattgaagaacttatggatttatatactcgtcaatgcgcagttgaa
gtaaactgcatcgatttagcacgtatcggcttaatttttgcaatggatggatatgatcca
tataaaaagaaacaaattatccctaaacatattacaaaaatttgcaaaacatttatggtc
acatgtggtatgtataacgaatctggtgaatttgcaattcgtgttggtattcctgcaaaa
agcggtgtagccggtggtatttttggctgcgtaaaaggagacatgggaatcggtattttc
ggaccagctttagatgcaaacggaaatagtattgctggttttaaaattcttgaacttctt
tctgctcaagaaggttggagcattttttaa

DBGET integrated database retrieval system