KEGG   Bacillus thuringiensis BMB171: BMB171_C0453Help
Entry
BMB171_C0453      CDS       T01239                                 

Gene name
hemL1
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00860  Porphyrin and chlorophyll metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMB171_C0453 (hemL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btb01007]
    BMB171_C0453 (hemL1)
Enzymes [BR:btb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BMB171_C0453 (hemL1)
Amino acid related enzymes [BR:btb01007]
 Aminotransferase (transaminase)
  Class III
   BMB171_C0453 (hemL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADH05271
Position
complement(521996..523294)
Genome map
AA seq 432 aa AA seqDB search
MNFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGKGAYFWDVDGNKYIDYLA
AYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSGTE
AVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVI
TVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYD
EVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGT
MAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGILEQAAKHNIDITLNRLKGALTV
YFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEA
VGRAFAALADNK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttcacaaagtcagaagcattacataaagaagctttagagcatatcgttggcggt
gttaacagtccttctcgttcttttaaagcagttggcggcggcgctcctgttgctatggaa
cgtgggaaaggcgcttatttctgggatgtagacggaaataaatatatcgattatttagca
gcatacggtcctattattactggacatgctcatccgcatataacaaaagcaattacaaca
gctgctgaaaatggggtactttatggaacaccaacagcgctagaggtaaaattcgcaaaa
atgttaaaagaagcaatgcctgcattagataaagtccgtttcgtaaactctggtacagaa
gcagtgatgacaacgattcgtgttgctcgtgcttatacaggtcgcacaaaaatcatgaaa
tttgctggttgttatcacggtcattctgatttagtacttgtggcagctggatctggccct
tctactttaggaactcctgactcagctggcgtaccacaaagtatcgcacaagaagttatt
accgttccatttaacaatgtagaaactttaaaagaagctttagataaatggggtcatgaa
gtagcagctatccttgtagaaccgatcgttggaaacttcggtattgtagagcctaaacct
ggattccttgaaaaagtgaatgaacttgttcacgaagctggcgcactagtaatttatgat
gaagttattactgcttttcgctttatgtacggcggtgctcaagacttacttggtgttaca
cctgacttaacagcgcttggtaaagttattggcggtggcttaccaatcggtgcttacggt
ggtaagaaagaaattatggaacaagttgctccgcttggacctgcataccaagctggtaca
atggcaggaaaccctgcttctatggcatcaggtatcgcttgtctagaagtacttcaacaa
gaagggctttatgagaagttagatgaacttggtgcaatgcttgaaaaaggaattttagag
caagcagcgaaacataatatcgacattacattaaatcgtctaaaaggggctttaactgta
tacttcacaactaatacaattgaagattacgatgccgcacaagatacagacggtgaaatg
ttcggtaaattcttcaagcttatgcttcaagaaggagttaacttagcaccttctaaatac
gaggcatggttcttaactacagaacatacaaaagaagatattgaatatacaatcgaagct
gtcggcagagcatttgctgccctagcagacaataaataa

DBGET integrated database retrieval system