KEGG   Bacillus thuringiensis BMB171: BMB171_C2290Help
Entry
BMB171_C2290      CDS       T01239                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase and related dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00010  Glycolysis / Gluconeogenesis
btb00071  Fatty acid degradation
btb00350  Tyrosine metabolism
btb00625  Chloroalkane and chloroalkene degradation
btb00626  Naphthalene degradation
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C2290
  Lipid metabolism
   00071 Fatty acid degradation
    BMB171_C2290
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMB171_C2290
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMB171_C2290
   00626 Naphthalene degradation
    BMB171_C2290
Enzymes [BR:btb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMB171_C2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ADH07102
Position
2469892..2470818
Genome map
AA seq 308 aa AA seqDB search
MEQYKLIVKGPKQLEWETNEIKDIQDDEIIVKTIAGSISIGAELPQYNGFDVTDPHPFYP
RKTGYESYGEVIEVGNQVTHVNVGDKVVSFYGHETIGIVKAHKVIRVPSSIQPKIALLSI
LSCDAAKGVLKLNPRQDEKVLIIGMGVIGLLACYFLKYYVGIEHVDVVEPNKNRRDFAKK
FGTKNIYDSEEKIIETYNYGFECSATNSGFHTLQKALKTNGKICILSDGNIEELTLTANF
YQKELQIIGSSDGYDYQKHADWFFEEIGKTPFIEEIFQHEIHYTSLIQCFDELSLGIIKP
LKVYVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatataagttaattgtaaaagggcctaaacaacttgagtgggaaacaaatgaa
attaaggacatacaggacgatgaaattatcgttaaaacgatcgcaggatcgataagcatt
ggggccgagttaccacagtataatggattcgatgttacagatccgcatcctttttatcca
agaaaaactggatatgaaagttatggtgaagtgattgaagttggtaatcaagtaacacat
gtaaacgtaggtgataaagtagtttctttttatggacatgaaacgatagggatagttaag
gcgcataaagtaattcgagtgcctagttctatacaacctaaaattgctttattatctatt
ctttcatgtgatgccgctaaaggagtattgaaactaaacccgcgacaggatgaaaaagta
cttataattggaatgggagttattggtttactcgcttgttatttcttaaaatactatgta
ggcattgagcatgtggatgttgttgagcctaataaaaatagaagagattttgcaaagaag
tttggtacgaaaaacatatatgattcagaagagaaaataatagaaacatataattatggt
ttcgaatgttctgctacaaatagtgggttccatactttgcaaaaagctcttaaaactaat
ggtaaaatatgtatactgtctgatggtaatatagaagaactaacattaactgctaacttt
tatcagaaagaattacaaattattggatcaagtgacggatacgattatcaaaaacatgca
gattggttttttgaagaaataggaaaaacaccatttatagaggagatctttcaacatgaa
atacattatacttcactcatacaatgttttgatgaattgagtttagggataattaaacca
ttaaaagtatatgtttcatatgaataa

DBGET integrated database retrieval system