KEGG   Bacillus thuringiensis BMB171: BMB171_C3687Help
Entry
BMB171_C3687      CDS       T01239                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00071  Fatty acid degradation
btb00072  Synthesis and degradation of ketone bodies
btb00280  Valine, leucine and isoleucine degradation
btb00310  Lysine degradation
btb00362  Benzoate degradation
btb00380  Tryptophan metabolism
btb00620  Pyruvate metabolism
btb00630  Glyoxylate and dicarboxylate metabolism
btb00640  Propanoate metabolism
btb00650  Butanoate metabolism
btb00900  Terpenoid backbone biosynthesis
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
btb01212  Fatty acid metabolism
btb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMB171_C3687
   00630 Glyoxylate and dicarboxylate metabolism
    BMB171_C3687
   00640 Propanoate metabolism
    BMB171_C3687
   00650 Butanoate metabolism
    BMB171_C3687
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMB171_C3687
   00072 Synthesis and degradation of ketone bodies
    BMB171_C3687
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMB171_C3687
   00310 Lysine degradation
    BMB171_C3687
   00380 Tryptophan metabolism
    BMB171_C3687
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMB171_C3687
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMB171_C3687
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMB171_C3687
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btb04147]
    BMB171_C3687
Enzymes [BR:btb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMB171_C3687
Exosome [BR:btb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMB171_C3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADH08497
Position
complement(3921960..3923135)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVKQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttggaggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacagctgcattagcggcaggatttcctgacacagttacg
ggatatacaatccaacgtcaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaatccaattaggtgtaagtgatgttgttgttgcaggtggggtagaagcgatgagttcg
agcccttatgcattgaaacagcaccgctggggacaacgtctacagcacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcaccatattatgatgggtgaaacagcg
gaaaatttagttaaacaatatgaaattacaagagaggaacaagatgaagttgctcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagagcgtagaaaagaagttgtattttcgaaggatgaacatccacgtgca
gatattacagctgaaaaattagctggattgaagccggcgttccgtaaagatggatcagtg
actgctggaaatgcatctggccttaatgacgggagtgcagttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggtttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatgggtattggaccagcaccagcaattcgtaaaggtttagaa
aaagtagattggtcattggaagatgcagatttacttgaaattaatgaagctttcgcggct
caatatttagctgtagagaaagagttaggcttagaccgtgaaaaagtgaacgtaaacggt
agtggcgtaggacttgggcatccaattggttgtacaggggctcgtattacagtaagttta
attcacgaattaaaaagacgtgggttagaaaaaggaattgcctctttatgcgtcggtggc
ggtatcggggttgccttatttatagaagcactataa

DBGET integrated database retrieval system