KEGG   Bacillus thuringiensis BMB171: BMB171_C4058Help
Entry
BMB171_C4058      CDS       T01239                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:btb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMB171_C4058
Enzymes [BR:btb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BMB171_C4058
DNA repair and recombination proteins [BR:btb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BMB171_C4058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_12 UvrD_C AAA T2SSE AAA_22 AAA_29 AAA_16 HHH_5 NTPase_1 Zeta_toxin AAA_28 AAA_18 TsaE DEAD GNAT_acetyltr_2 DUF4926 AAA_17
Motif
Other DBs
NCBI-ProteinID: ADH08867
Position
complement(4259770..4261857)
Genome map
AA seq 695 aa AA seqDB search
MVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIVDHLGEHAISKIMDDPEALNGVVN
KQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKIYQQYKEMTLEVIRNNPYQLIEEV
DGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVSLQLGHVYMRKDQLVRETMSLLNN
QEGRVTEEDIIGCIETMQSEGKVIIEEERVYLATLFYSEKGVVKSIRRLMNQEETPSFPE
AEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLLTGGPGTGKTTVIKGIVEMYASLH
GLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLPACTIHRLLGWTPEGSFQRNETDP
VQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGDEDQLPSVGPGQVLKDLLNAGAVP
TVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNKKDRSFISCTGAQIVEVVKKVCENA
KTKGFSARDVQVLAPMYRGPAGINVLNEALQQVFNPKREKSKEIAYGDVVYRRGDKVLQL
VNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFDGIEVTYTKPDLNQITHAYCCSIH
KSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKFLIICGEEAAFQSGVNRLDDAMRQ
TTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaacatttaaaaaagaattgccgcaaacaaaagcaggtatggtgcaatattta
gcgagtgatttatttaaagggataggaaagcgtacagctgaaaaaattgtggaccatctc
ggagaacatgctatttctaaaattatggatgaccctgaggcattaaatggtgttgttaat
aaacaaaaggctcaggaaatatatgagacaattgttgaacatcaaggattagagaaagta
atgagctttttaaatggctacggttttggaacgaaactttctattaagatttaccagcaa
tataaagagatgacattagaagtgattcgtaataatccgtatcaacttattgaagaagtg
gacgggattggttttggaagagcggatgatatagggcgtgcgttagggatatcgggtaat
catgacgaccgtgtacgagcgggatgtttttacacattagagaatgtctcattacaactt
ggtcatgtttatatgaggaaagatcaacttgtaagagaaacgatgtcacttttaaacaat
caagaaggaagagtgactgaggaagatattataggttgtattgaaacgatgcaaagtgaa
gggaaagtcatcatagaagaagaacgagtgtatttagcgacgttattctactctgaaaaa
ggtgttgtaaagtctattcgcaggcttatgaatcaagaagaaacaccttcatttccagaa
gcggaagtgttaaaaacgttaggtgaaattgaagaacaactgaacgtacaatatgcaccg
tttcagcaagaagcaattcaaacggcacttcataaaccgatgatgttattgacaggtgga
ccaggaacagggaaaacaacagttattaaagggattgttgaaatgtatgcgtcacttcac
ggattatcgttaaatccgaatgaatacagtgatgataatccatttccaatactattaaca
gctccaacaggaagagcagcgaagcggatgagtgaatcgacaggacttccagcttgcaca
attcaccgtttacttggttggacgccagaaggatctttccagcgtaatgaaacggatcct
gtccaaggtaagctccttattatcgatgaattttcaatggttgatatttggcttgcaaat
cagctatttaagtcgttgccgacgaatattcaagttatcgttgtaggtgatgaagatcag
ttgccatctgtaggacctggacaagtattaaaagatttattaaatgcaggcgcagttccg
acagtgaagcttactgaaatttatcgtcaagcggaaggctcatcagtgattcaacttgcc
catgcgataaaaaatggaactctaccaccagatttagcgcaaaacaaaaaagatcgttcg
tttatcagctgtacaggggctcaaattgttgaggttgtgaaaaaagtttgcgaaaatgct
aaaacaaaaggctttagtgcaagggatgttcaagtattagcaccgatgtaccgcgggcct
gctggtattaatgtattaaacgaagcgctgcaacaagtatttaatccgaagagggaaaag
agtaaagaaattgcttacggcgatgttgtgtaccgaagaggcgataaagtactgcaactc
gtgaatcagccggagagccaagtgtttaatggtgatattggggaaattgtttcggtgttt
tatgcgaaagagaacgttgagcaacaagatatgattatcgtttcatttgatggaattgag
gtaacgtatacgaagcccgatttaaatcaaattacgcatgcatattgttgttccattcat
aaatcacaaggtagtgaatttccgattgttattatgccaatcgtgaaaagttacaaccgt
atgttacgtcgtaatttaatttacacgggtattacaagaagtaagaagttccttattatt
tgtggggaggaagcagctttccaatctggtgtaaatcgccttgatgatgcaatgcgtcaa
acaactttagctagtcgcttgcaagaatcacaaggagaagtacagatggtcacagttaat
ggcgaggaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system