KEGG   Bacillus thuringiensis BMB171: BMB171_C4170Help
Entry
BMB171_C4170      CDS       T01239                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00071  Fatty acid degradation
btb00362  Benzoate degradation
btb01100  Metabolic pathways
btb01120  Microbial metabolism in diverse environments
btb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BMB171_C4170
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMB171_C4170
Enzymes [BR:btb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMB171_C4170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADH08979
Position
complement(4378429..4379205)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGL
FSEESLLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQRESQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggcgacgttaaatcac
gcaccagcgaatgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggaaaaggatgataacattcgtgttgttgttattcacggtgaaggacgtttcttctca
gcaggagcagatattaaagaatttacatctgttactgaagcgaagcaagcaacagaatta
gcacagcttggacaagttacgtttgagcgtgttgaaaaatgttcaaaaccagttattgcg
gcaattcatggagcggcactgggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctggc
tttgcaggtacacagcgcttaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccaattactggtgcagaagcattaaagtggggacttgttaacggattg
ttctctgaagaatctcttttagatgatacgcttaaagttgcaaaacaaattgctggaaaa
agtccagcaacaactcgtgctgtactagagttattgcaaacgacaaaatcgtctcattac
tatgaaggtgtacaacgtgaatcacaaatttttggtgaagtatttacgagtgaagatgga
agagaaggtgtagccgcatttttagaaaagcgcaaaccttcatttagtggcaggtag

DBGET integrated database retrieval system