KEGG   Bacillus thuringiensis BMB171: BMB171_C4506Help
Entry
BMB171_C4506      CDS       T01239                                 

Gene name
glgB
Definition
(GenBank) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00500  Starch and sucrose metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMB171_C4506 (glgB)
Enzymes [BR:btb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BMB171_C4506 (glgB)
Exosome [BR:btb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMB171_C4506 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase CBM_48
Motif
Other DBs
NCBI-ProteinID: ADH09314
Position
complement(4708282..4710021)
Genome map
AA seq 579 aa AA seqDB search
MLQVTEEGIWSLFIPHIEEGEIYKYAIETLAGDVILKADPYAVYAEVRPNTASVVFDIKG
YEWNDKNWNRKKKKKSIYKEAMTVYELHFGSWKKKEDGTLYSYREMVEELIPYVVEHQFT
HIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFC
KDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRYFHIDGF
RVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLVTTPTYE
GGLGFNYKWNMGWMNDVLKYMECAPEYRKHIHEKMTFSLLYAYSENFILPLSHDEVVHGK
KSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDWNLHDFE
MHRYMHDYFKELIALYKRSKPLWQLDHSPEGFQWIDANNNEQSIFSFIRQGDKQEDALVI
VCNFTKATYENYKVGVPDFEYYNEILNSDAQQYGGSGQVNKKRLKTILEPYHNQAAHVEI
TIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgctacaagtgacagaagaaggcatttggtccttatttataccgcatattgaagaagga
gaaatatataaatatgcgattgaaacattggctggtgacgtcattttaaaggcagatccg
tatgctgtatatgcagaagtaagaccgaatacggcatctgtagtttttgatataaaagga
tatgaatggaatgataaaaactggaatcgtaagaaaaagaaaaaatcgatttataaagaa
gcgatgacagtttatgaattacattttggttcttggaaaaagaaagaagatggaacgctg
tactcttacagggaaatggttgaagagctcatcccgtatgtggtggaacatcaatttaca
catattgaaattatgccgcttgttgagcatccatatgatcgttcttggggataccaagga
acgggatattatgcagcgacgagtagatttggtacgccgcatgatttaatgcattttgtc
gacgaatgtcataaatatggaatcggtgtcattttagattgggtgccggggcatttttgt
aaagatgctcacggtttatatttgtttgatggtacaccgacctatgaatataaagataaa
gatgtacaagaaaatccagtatggggaactgtcaattttgatttaggaaagagagaggta
cgtaatttcttaatttcaaatgcgttattttggatgagatatttccatattgatggtttc
agagttgatgcagttgcgaacatgttgtactggaataaagaaggacaagagcaaagtaat
gagcatgctgtttcatttttaagggagttaaatgaagcagtgtttgcagaggatgaagat
tttcttatgacggcagaagattcaacagcttggccacttgtaacaactccaacgtatgaa
ggtgggcttggattcaattacaaatggaacatgggctggatgaatgacgtgctgaaatat
atggagtgtgcgcctgaatataggaaacacattcatgagaaaatgacgttttctttgcta
tatgcgtactctgaaaacttcatattaccgctttctcatgatgaagtcgttcatgggaaa
aagtcgttattaaataaaatgccaggtgattactgggataagtttgctcagcttcgttta
ttatatggatatttctttactcacccaggaaagaaattacttttcatgggaggggaattc
ggacagtttgatgagtggaaagaccttgaagatttagattggaatttacatgattttgaa
atgcatcgttatatgcatgattactttaaagagctcatagcattgtataagcgctcaaaa
ccactttggcagcttgatcattcgcctgaaggttttcagtggattgatgctaataataac
gagcaaagtattttctcgtttatccgccaaggggataaacaagaggatgcgttagttatc
gtatgtaattttacgaaagctacatatgaaaactataaagtaggtgtaccagatttcgag
tattataacgagattttaaacagtgatgcacagcaatatggcggttcggggcaagtgaat
aagaaacgtcttaagacgattctagaaccgtaccataatcaagcagcacatgtagagatt
acaattccaccatttggcgtatccatattacgaccagtgaagacgagaaaggggagcaaa
aaacaagatggctcaaaaacaaaagtgcgtagcaatgttactagcagggggaaaaggtag

DBGET integrated database retrieval system