KEGG   Bacillus thuringiensis BMB171: BMB171_C4999Help
Entry
BMB171_C4999      CDS       T01239                                 

Gene name
metA
Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00270  Cysteine and methionine metabolism
btb00920  Sulfur metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01130  Biosynthesis of antibiotics
btb01230  Biosynthesis of amino acids
Module
btb_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:btb00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BMB171_C4999 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMB171_C4999 (metA)
Enzymes [BR:btb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BMB171_C4999 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     BMB171_C4999 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS GATase DUF5416
Motif
Other DBs
NCBI-ProteinID: ADH09807
Position
complement(5231301..5232206)
Genome map
AA seq 301 aa AA seqDB search
MPIIIDKDLPARKVLQKENIFVMTKERAETQDIRALKIAILNLMPTKQDTEAQLLRLIGN
TPLQLDVHLLHMESHLSRNVTQEHLTSFYKTFRDIENEKFDGLIITGAPVETLAFEEVDY
WEELKHIMEYSKTNVTSTLHICWGAQAGLYYHYGVPKYPLKEKMFGVFEHEVCEQHVKLL
QGFDELFFAPHSRHTEVRENDIREVKELTLLANSEEAGVHLVIGPEGRQVFALGHSEYSC
ETLKQEYERDRDKGLNIDVPKNYFKHNNPDEKPLVRWRSHGNLLFSNWLNYYVYQETPYI
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcataattgataaagatttaccggctcgcaaagtgttgcaaaaagaaaatatt
tttgtaatgacgaaggagcgggcagaaacacaagatatacgtgctttaaaaattgctata
ttaaatttaatgccaacgaagcaagacacagaggcgcaattacttcgcttaattggaaac
acaccgttacaattagatgttcatttgcttcatatggaatcacatctatcgcgtaatgta
acgcaagaacatttaacaagcttttataaaacgtttcgtgatattgaaaatgaaaagttt
gatgggctcattattacaggagcgccagtggagacccttgcttttgaagaggtagattat
tgggaagagcttaaacatattatggagtattcaaaaacgaatgtaacatctacgctccat
atttgctggggggcacaggctggcttgtactatcattatggtgttccaaagtatcccctt
aaggaaaaaatgtttggtgtatttgaacatgaagtttgcgagcaacatgtgaaattatta
caaggatttgatgaattgttttttgctccgcattctcgtcatacagaagtacgagagaat
gatattagagaagtgaaagaattaacattgttagcaaactctgaagaagcaggtgttcac
cttgttattgggccagaaggaaggcaagtgtttgcccttggacatagcgaatatagttgt
gagacgttaaaacaagaatacgaacgagatcgtgacaagggattaaatattgatgtgcca
aaaaactattttaaacataataatccagatgaaaagccgcttgttaggtggaggagtcat
ggtaatttattgttttctaattggttgaattattacgtgtatcaagaaaccccttatata
ttgtaa

DBGET integrated database retrieval system