KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0113Help
Entry
CT43_CH0113       CDS       T01838                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:btc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CT43_CH0113 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:btc03011]
    CT43_CH0113 (rplV)
Ribosome [BR:btc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CT43_CH0113 (rplV)
  Bacteria
    CT43_CH0113 (rplV)
  Archaea
    CT43_CH0113 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 BAR_3_WASP_bdg
Motif
Other DBs
NCBI-ProteinID: AEA13806
Position
133021..133362
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASPVVEKVLKSAIANAEH
NYEMDINNLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHITVVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagcagtagcgagaacagttcgtattgctcctcgtaaagttcgtttagta
gtagacttaatccgaggtaagcaagtgggtgaagcgattgctatccttaaccacacacca
aaaactgcttctccagttgtagaaaaagttttaaaatctgcaatcgcaaatgcagagcac
aattatgagatggacattaacaacctagttgttgaaaaagtcttcgttgacgaaggtcca
acgttgaaacgtttccgtccacgtgcaatgggtcgtgcaagccaaattaacaaacgcaca
agccacattacagttgtggtatcagaaaagaaggagggataa

DBGET integrated database retrieval system