KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0151Help
Entry
CT43_CH0151       CDS       T01838                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00220  Arginine biosynthesis
btc00330  Arginine and proline metabolism
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01130  Biosynthesis of antibiotics
btc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    CT43_CH0151 (rocF)
   00330 Arginine and proline metabolism
    CT43_CH0151 (rocF)
Enzymes [BR:btc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CT43_CH0151 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEA13844
Position
161835..162728
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEIDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatctcagttattggagttccaatggatttagggcagatgcgtcgtggc
gttgatatgggaccgagcgcaatccgttatgcaggggtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagagatagatgaa
aatacaaaattaagaaaccttacacaagttgcaactgtatgtaatgaattagcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatt
gctatcggtacattagctggtgtagcaaaacattataaaaacttaggtgttatttggtat
gatgcacacggtgatttaaatacagaggaaacttcaccatctggaaatattcacggtatg
tcacttgcagcaagtttagggtatggacattcttcacttgtagatttatatggagcatat
ccaaaggtgaaaaaagagaatgtcgtaattatcggtgcgcgtgcattggatgaaggagaa
aaagatttcattcgcaatgaaggtattaaagtgttctcaatgcatgaaattgatcgtatg
gggatgacggctgttatggaagaaacaatcgcatatttatctcatactgatggtgtacac
ttatcattagatttagatggtcttgatcctcatgatgcaccaggtgttgggacgcctgta
attggtggtctatcttatcgtgaaagccacttggcgatggaaatgttagcagaagcggat
attatcacatctgctgaatttgttgaggtaaatacgattttagatgagagaaatagaacg
gcaacaacagcagttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system