KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH1176Help
Entry
CT43_CH1176       CDS       T01838                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00260  Glycine, serine and threonine metabolism
btc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01130  Biosynthesis of antibiotics
btc01230  Biosynthesis of amino acids
Module
btc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT43_CH1176 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CT43_CH1176 (trpA)
Enzymes [BR:btc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CT43_CH1176 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB NMO
Motif
Other DBs
NCBI-ProteinID: AEA14864
Position
1251231..1252007
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGFEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQLPFVLMTYLNPVLAFGKERFVENCLEAGV
DGIIVPDLPYEEQNIIAPLLREANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHVNLPVVAGFGISTKEHVEEMVTICDGVVVGSKIIELLETE
KREEICELIYATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcgtttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggctttgaaaaattaaaagaaagaattcgttttttagatgaa
gcaggagcgagcatcgttgaaatcggcattccgttttcggatccagttgcagacggtcca
acgattcaaagagcagggaaacgagcgctagatagcggtgtaacagtaaaaggtattttt
caagcattaatagaggtaaggaaagaagtgcaacttccgtttgtactcatgacatattta
aatccagtacttgcattcggaaaagaacgatttgtagagaactgcttagaggccggtgtg
gatggtattatcgttccagacttaccgtatgaagaacaaaatattattgcgccgttactt
cgagaggcaaacattgcgctcattccactcgttaccgtaacgagtcctattgaaagaatt
gaaaaaattacgagtgaatcagaagggttcgtttatgctgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaatcacac
gtcaacttaccagtagtcgctggattcggcatttcaacaaaagaacatgtagaagaaatg
gttacaatatgcgacggagttgtcgttggaagtaagatcattgagcttttagaaactgaa
aagcgagaagaaatatgtgaattaatatatgcaacaaaacaaaaagaagaggcgtag

DBGET integrated database retrieval system