KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH2051Help
Entry
CT43_CH2051       CDS       T01838                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00670  One carbon pool by folate
btc01100  Metabolic pathways
btc01120  Microbial metabolism in diverse environments
btc01200  Carbon metabolism
Module
btc_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:btc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CT43_CH2051 (fhs)
Enzymes [BR:btc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CT43_CH2051 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AEA15735
Position
2060356..2062044
Genome map
AA seq 562 aa AA seqDB search
MTTTTTVKSDIEIAQEASMKKIQEIAADLNILEDELEPYGHYKGKLSLDIFKRLQDEKDG
KVVLVTAINPTPAGEGKSTVTVGLGQAFNKIGKKTVIALREPSLGPTMGLKGGAAGGGFS
QVVPMEDINLHFTGDIHAITTANNALAAFIDNHIQQGNTLGIDTRKIVWKRCVDLNDRAL
RNVVIGLGGPVQGVPREDGFDITVASEIMAVFCLATDIQDLKARLSRIVVAYNFANQPVT
VKDLGVEGALTLLLKDALKPNLVQTLENTPAIIHGGPFANIAHGCNSVIATTMAAKLGDY
VITEAGFGADLGAEKFLDIKARAAGIKPEAVVIVATIRALKMHGGVAKDQLKEENVDALA
KGMENLQKHVETIQSFGVPFVIAINKFITDTDAEVTYLQEWCNERGYAVSLTEVWEKGGQ
GGVDLAEKVLKEIEKGENNYAPLYELELPLEEKIRTIAQKVYGAKDIEFAPKARKQLAQY
EGEGWSNLPVCMAKTQYSLSDDATKLGRPSDFIVTIRELKPSIGAGFIVALTGTMLTMPG
LPKQPAALQMDVNEDGKAVGLF
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacaactactacaacagtgaaatccgatattgaaatcgcacaagaagcgagtatgaag
aagattcaagaaattgcagctgatttaaatattttagaagatgaattagagccatacggg
cattataaaggtaagttatctcttgatatttttaagcgcttacaagatgagaaagacggt
aaagttgttttagtaacagcaattaacccaactccagctggagaaggtaaatcaacagta
acagttggtttaggtcaagcttttaacaaaattggtaagaaaacagtaattgcacttcgt
gaaccatctcttggaccgacgatgggattaaagggtggagcagcaggtggcggtttttca
caagtcgtaccaatggaagacattaaccttcactttactggagatatccatgcgatcaca
actgccaataacgcattagcagcgtttattgataatcatatccaacaaggaaacacactt
ggaattgatacgcgtaaaattgtttggaaacgctgtgttgacttaaatgatcgtgccctt
cgtaacgtagtaattggtcttggtggacctgtacaaggtgtaccacgtgaagacggtttt
gacattacagtcgcatctgaaattatggccgtattctgccttgcaacagatattcaagac
ttaaaagcgcgtctatctcgcatcgtagttgcttataactttgcaaatcaacctgtaacg
gttaaagatttaggtgtagaaggtgcgttaacgctattattaaaagacgcattaaaacca
aacttagtacaaacattagaaaatacaccagctattattcatggcggaccatttgcgaat
attgctcacggttgtaacagtgttatcgctacgacaatggcagcaaaattaggtgattat
gttattacagaagctggatttggtgctgatttaggcgctgagaagtttttagatattaaa
gctcgtgcagctggcattaaaccagaagcagttgttattgttgcgacgattcgtgcgctt
aaaatgcatggtggcgtagcaaaagatcaattaaaagaagaaaatgtagatgcattagca
aaaggtatggaaaacttacagaagcatgttgaaacaattcaaagctttggtgtgcctttc
gtaattgcaattaataaattcattacagatacagatgcagaagttacatacttacaagag
tggtgtaatgagcgtggctatgcagtatccttaacagaagtttgggagaagggtggccaa
ggcggagttgaccttgctgaaaaagtactaaaagaaatcgaaaaaggtgaaaacaactac
gcaccactttatgaattagaattaccattagaagaaaaaattcgtacaattgctcaaaaa
gtgtatggcgcaaaagatattgaatttgctccgaaagcacgtaagcaattagctcaatat
gaaggagaaggttggagtaacctaccagtttgtatggcgaaaacacaatactctctttct
gacgatgcaacaaaattaggtcgtccatctgactttatcgttacaattcgtgagttaaaa
ccatctatcggtgcaggctttatcgttgcgttaacaggtacaatgttaacaatgccaggt
cttccaaaacaaccagcagcacttcaaatggatgtaaatgaagatggaaaagcagtaggt
ttattctaa

DBGET integrated database retrieval system