KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH2393Help
Entry
CT43_CH2393       CDS       T01838                                 

Gene name
gpm
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00010  Glycolysis / Gluconeogenesis
btc00260  Glycine, serine and threonine metabolism
btc00680  Methane metabolism
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01120  Microbial metabolism in diverse environments
btc01130  Biosynthesis of antibiotics
btc01200  Carbon metabolism
btc01230  Biosynthesis of amino acids
Module
btc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btc_M00002  Glycolysis, core module involving three-carbon compounds
btc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH2393 (gpm)
  Energy metabolism
   00680 Methane metabolism
    CT43_CH2393 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT43_CH2393 (gpm)
Enzymes [BR:btc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CT43_CH2393 (gpm)
Membrane trafficking [BR:btc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CT43_CH2393 (gpm)
Exosome [BR:btc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CT43_CH2393 (gpm)
  Exosomal proteins of melanoma cells
   CT43_CH2393 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEA16074
Position
2407274..2408011
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLTWVPIHKSWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSVDVR
PPALTEDDPRYEATDPRYKTLKKGEFPLTECLEDTEKRVLAYWHSEIAPTLKSGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacaaagcttatggaatcttgaaaatcgcttt
actggatggacagatgttgatctatcagagaatggattaagtgaagcgagagaagcagga
gcaatattaaagaaaaacggatatacttttgatgtggcttatacatcagtattaaaacgc
gcaattcggacgttatggattgtacttcatgagatggatcttacttgggttccaatacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggctgaataaagatgaa
actgcacaaaaatatggtgaggagcaagttcatatttggagaagaagtgttgatgtaaga
ccaccggctcttactgaagacgatcctcgatatgaagcgaccgatccaagatataaaaca
ctcaaaaaaggtgaatttccattaactgaatgtttagaggatacggagaagagagtactt
gcttattggcattcagaaattgcgccgacattaaaaagtggtaacaaagtaattatttca
tcacacggtaacacaattcgctcgctagtaaaatatttagacaacctttcaagtgatggt
gtagtttcattaaatattcccactagcattccgcttgtttatgaattagacgaaaactta
cgtccgattcgtcattattatttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system