KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH4738Help
Entry
CT43_CH4738       CDS       T01838                                 

Gene name
gdH
Definition
(GenBank) glucose-1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00030  Pentose phosphate pathway
btc01100  Metabolic pathways
btc01120  Microbial metabolism in diverse environments
btc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CT43_CH4738 (gdH)
Enzymes [BR:btc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     CT43_CH4738 (gdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase DUF1776 DUF460
Motif
Other DBs
NCBI-ProteinID: AEA18397
Position
complement(4694835..4695620)
Genome map
AA seq 261 aa AA seqDB search
MYSDLEGKVVVITGSATGLGRAMGVRFAKEKAKVVINYRSRESEANDVLEEIKKVGGEAI
AVKGDVTVESDVVNLIQSAVKEFGTLDVMINNAGIENAVPSHEMPLEDWNKVINTNLTGA
FLGSREAIKYFVEHDIKGSVINMSSVHEKIPWPLFVHYAASKGGIKLMTETLALEYAPKG
IRVNNIGPGAINTPINAEKFADPKKRADVESMIPMGYIGKPEEIAAVATWLASSEASYVT
GITLFADGGMTLYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgatttagaaggaaaagtggtcgttattacaggatcagcaactggtcttggt
agggcgatgggagtaaggtttgctaaggaaaaagcgaaagtggttattaattatcgctca
cgagaatcagaagcaaatgatgtgttagaagaaattaaaaaggtaggcggagaagcgatt
gctgtaaaaggtgatgtaaccgtcgaatcagatgttgtgaatctcattcaatctgctgtg
aaagaatttggtacgctcgacgttatgattaataatgcagggatagaaaatgcagtacca
tcgcatgaaatgccacttgaagattggaataaagtaatcaatacaaatttaacaggtgct
ttcttaggaagtagagaagcgattaaatattttgtagaacatgacattaaagggtctgtc
attaatatgtctagtgttcatgagaaaattccgtggccactatttgtgcactatgcagcg
agtaagggtggcattaaactgatgacagaaacgttagcgctagaatatgcgccaaaaggt
attcgagtaaataatataggaccaggtgcaattaatacgccgatcaatgcagaaaaattt
gctgatcctaaaaaacgtgctgacgtagaaagtatgataccgatgggctacattggaaaa
ccagaagaaattgcagcagtagcaacttggctcgcttcttcagaggcgagttatgtaacg
ggaattacgctatttgcagatggtggaatgacgttatatccatcgtttcaagctgggcgt
gggtaa

DBGET integrated database retrieval system