KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH5165Help
Entry
CT43_CH5165       CDS       T01838                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00010  Glycolysis / Gluconeogenesis
btc00051  Fructose and mannose metabolism
btc00562  Inositol phosphate metabolism
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01120  Microbial metabolism in diverse environments
btc01130  Biosynthesis of antibiotics
btc01200  Carbon metabolism
btc01230  Biosynthesis of amino acids
Module
btc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btc_M00002  Glycolysis, core module involving three-carbon compounds
btc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT43_CH5165 (tpiA)
   00051 Fructose and mannose metabolism
    CT43_CH5165 (tpiA)
   00562 Inositol phosphate metabolism
    CT43_CH5165 (tpiA)
Enzymes [BR:btc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CT43_CH5165 (tpiA)
Exosome [BR:btc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CT43_CH5165 (tpiA)
  Exosomal proteins of bladder cancer cells
   CT43_CH5165 (tpiA)
  Exosomal proteins of melanoma cells
   CT43_CH5165 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEA18821
Position
complement(5105835..5106590)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPEAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcaactgaaggaactgacttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagttggctatgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagacgaatcagtaaacaaaaagactatcgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagacgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gaagctgcagaagctgttcgtatccaatacggcggtagcgtaaaaccagaaaacattaaa
gagtatatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system