KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH5384Help
Entry
CT43_CH5384       CDS       T01838                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00071  Fatty acid degradation
btc00072  Synthesis and degradation of ketone bodies
btc00280  Valine, leucine and isoleucine degradation
btc00310  Lysine degradation
btc00362  Benzoate degradation
btc00380  Tryptophan metabolism
btc00620  Pyruvate metabolism
btc00630  Glyoxylate and dicarboxylate metabolism
btc00640  Propanoate metabolism
btc00650  Butanoate metabolism
btc00900  Terpenoid backbone biosynthesis
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01120  Microbial metabolism in diverse environments
btc01130  Biosynthesis of antibiotics
btc01200  Carbon metabolism
btc01212  Fatty acid metabolism
btc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CT43_CH5384
   00630 Glyoxylate and dicarboxylate metabolism
    CT43_CH5384
   00640 Propanoate metabolism
    CT43_CH5384
   00650 Butanoate metabolism
    CT43_CH5384
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CT43_CH5384
   00072 Synthesis and degradation of ketone bodies
    CT43_CH5384
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CT43_CH5384
   00310 Lysine degradation
    CT43_CH5384
   00380 Tryptophan metabolism
    CT43_CH5384
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CT43_CH5384
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CT43_CH5384
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CT43_CH5384
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btc04147]
    CT43_CH5384
Enzymes [BR:btc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CT43_CH5384
Exosome [BR:btc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CT43_CH5384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Ribosomal_S16
Motif
Other DBs
NCBI-ProteinID: AEA19038
Position
complement(5325849..5327030)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVAASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
TPYILRGARWGYRMGNNEVIDLNVADGLTCAFSGTHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHKEGRFEEEIVPVTIPQRKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKEA
AVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKTIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccagttggaaaatttggaggatct
ttaaaagatgtaaaagcgacggaacttggaggaattgcaattaaagcagcgcttgaaaga
gcaaatgttgcggctagtgatgttgaagaagttatatttggaacggttattcagggggga
caggggcaaattccatcgcgtcaagctgcaagggctgctggaatcccttgggaagtgcag
acggaaacagtgaataaagtttgtgcatcaggacttcgtgcggttacgttagcggatcaa
attattcgtactggcgatcaatcactgattgtagctggcggtatggagtcgatgagtaat
actccttacattttacgcggagcaagatggggatacagaatgggcaacaatgaagttatt
gatttaaacgttgctgacggtttaacatgcgcattttcaggtacacacatgggtgtttat
ggcggagaagttgcgaaggaagatgggatttctcgcgaagcgcaagatgaatgggcatat
cgtagccatcagcgtgcggtttcagcgcataaagaaggacgttttgaagaggaaatcgta
ccagtaacgatcccgcaaagaaaaggcgatcctattgttgttgcaaaggatgaggcgcca
cgtgaagatacaacgattgaaaagttagcaaagttaaaacctgtatttgataaggaagcg
gcggtgacagctggtaatgcgccaggactaaacgatggtggtgccgcacttgtgttaatg
agcgaagacagagcgaagcaagaaggaagaaagccattagcgacaattttggcgcataca
gcaattgcagtggaatctaaagatttcccaagaacgccaggttatgcaattaacgcattg
cttgaaaaaacaggaaagacaattgaagacatcgatttattcgagattaatgaagcattt
gcagcggtagcaattgcaagtacagaaatcgcaggaattgatccagaaaaattgaatgta
aatggcggcgcggtagcgatgggccatccaattggagcaagcggagcgcgcattatcgtt
acactaatccatgcacttaagcagcgcggcggcggaattggaattgcatcgatttgtagc
ggtggcggtcaaggagacgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system