KEGG   Burkholderia thailandensis MSMB121: BTI_1116Help
Entry
BTI_1116          CDS       T02644                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00540  Lipopolysaccharide biosynthesis
btd01100  Metabolic pathways
Module
btd_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BTI_1116 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:btd01005]
    BTI_1116 (rfaD)
Enzymes [BR:btd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BTI_1116 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:btd01005]
 Unusual sugar
  BTI_1116 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: AGK49426
Structure
PDB: 

Position
1:1212178..1213170
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGANIVKALNERGETRIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVER
FARGDFGKVRAVFHEGACSDTMETDGRYMMDNNFRYSRAVLDACLAQGAQFLYASSAAIY
GGSSRFVEEREVEAPLNVYGYSKFLFDQVIRRVMPSAKSQIAGFRYFNVYGPRESHKGRM
ASVAFHNFNQFRAEGKVKLFGEYNGYGPGEQTRDFVSVEDVARVNLYFFDHPEKSGIFNL
GTGRAQPFNDIATTVVNTLRALEGKSALTLAEQVEQGLVEYVQFPDALRGKYQCFTQADQ
TKLRAAGYDAPFLTVQEGVDRYVRWLFGQL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgactctcatcgttaccggcgcggccggcttcatcggcgcgaacatcgtcaaggcgctg
aacgagcgcggcgagacgcgcatcatcgcggtcgacaacctgacgcgcgcggacaagttc
aggaacctcgtcgattgcgagatcgacgactatctcgacaagaccgaattcgtcgagcgc
ttcgcgcgcggcgacttcggcaaggtgcgcgcggtattccacgaaggcgcctgctcggac
acgatggaaaccgacggccgctacatgatggacaacaacttccgctacagccgcgcggtg
ctcgacgcgtgcctcgcgcagggcgcgcagttcctgtatgcgtcgtcggccgcgatctac
ggcggctcgagccgcttcgtcgaggagcgcgaggtcgaggcgccgctcaacgtatacggc
tattcgaagttcctgttcgatcaggtgatccgtcgcgtgatgccgagcgcgaagagccag
atcgcgggctttcgctacttcaacgtgtacgggccgcgggagtcgcacaaggggcgcatg
gcgtcagtcgcgttccacaacttcaaccagttccgcgccgagggcaaggtcaagctgttc
ggcgagtacaacggctacggcccgggcgagcagacgcgcgatttcgtgtcggtcgaggac
gttgcgagggtgaacctgtatttcttcgatcatccggagaagtcgggcatcttcaatctc
ggcaccggccgcgcgcagccgttcaacgacatcgcgacgacggtcgtcaacacgctgcgc
gcgctcgaaggcaagtccgcgctcacgctcgccgagcaggtcgagcaggggctcgtcgaa
tacgtgcagtttccggacgcgctgcgcggcaaataccagtgcttcacgcaggccgaccag
acgaagctgcgcgcggccggctacgatgcgccgttcctgacggtgcaggaaggcgtcgat
cgctacgttcgttggctgttcggccaactgtaa

DBGET integrated database retrieval system