KEGG   Burkholderia thailandensis MSMB121: BTI_1239Help
Entry
BTI_1239          CDS       T02644                                 

Gene name
hisQ
Definition
(GenBank) histidine transport system permease protein hisQ
  KO
K10016  histidine transport system permease protein
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:btd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTI_1239 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btd02000]
    BTI_1239 (hisQ)
Transporters [BR:btd02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BTI_1239 (hisQ)
   Histidine transporter
    BTI_1239 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGK46765
Position
1:1337995..1338684
Genome map
AA seq 229 aa AA seqDB search
MFLYGFGPLIWAGTVQTIELSVLSLAAAVLLGLAGAIAKLSHNRVLRAIATGYTTLIRSV
PDLVLMLLLFYSIQIWLNQFTDLMNWDQIDIDPFVAGVLTLGFIYGAYFTETFRGAFLAV
PRGQLEAGSAYGMGGMRVFVRIMFPQMMRFALPGIGNNWQVLVKATALVSIIGLADIVKA
AQDAGKSTFNMFFFILVAALVYLAITTASNLVLKQLEKRYSIGVRHAEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctatacggctttggtccgctcatctgggcgggcaccgtgcagacgatcgagctg
tcggtgctgtcgctcgcggcggcggtgctgctcggcctcgccggcgcgatcgcgaagctc
tcgcacaatcgcgtgctgcgcgcgatcgcgacgggctacacgacgctcatccgctcggtg
cccgatctcgtgctgatgctgctgctgttctacagcatccagatctggctcaaccagttc
accgatctgatgaactgggatcagatcgacatcgatccgttcgtcgccggcgtgctgacg
ctcgggttcatctacggcgcgtatttcaccgagacgttccgcggcgcgttcctcgcggtg
ccgcgcggtcagctcgaggcgggcagcgcgtacgggatgggcgggatgcgcgtgttcgtg
cggatcatgtttccgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaggcgaccgcgctcgtgtcgatcatcggtctcgccgacatcgtgaaagcc
gcgcaggacgcgggtaagagcacgttcaacatgttcttcttcattctcgtcgcggcgctc
gtctatctggcgatcacgacggcctccaatctcgtgctcaagcagctcgagaagcgttat
tccatcggcgtgaggcacgcggaactatga

DBGET integrated database retrieval system