KEGG   Burkholderia thailandensis MSMB121: BTI_1242Help
Entry
BTI_1242          CDS       T02644                                 

Gene name
hisP
Definition
(GenBank) histidine transport ATP-binding HisP domain protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:btd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTI_1242 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btd02000]
    BTI_1242 (hisP)
Enzymes [BR:btd01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BTI_1242 (hisP)
Transporters [BR:btd02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BTI_1242 (hisP)
   Histidine transporter
    BTI_1242 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_21 AAA_13 SMC_N
Motif
Other DBs
NCBI-ProteinID: AGK46360
Position
1:1339940..1340209
Genome map
AA seq 89 aa AA seqDB search
MHPDVMLFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQG
RVEEEGAPAEVFGGTKSERLKQFLSGSLK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgcacccggacgtgatgctgttcgacgagccgacgtcggcgctcgatccggagctggtc
ggcgaagtgctgaaggtgatgcagaagctcgcggaggaagggcggacgatgatcgtcgtc
acgcacgagatgggctttgcgcgcaacgtgtcgaatcacgtgatgttcctgcaccagggt
cgcgtcgaggaggaaggcgcgcctgccgaggtgttcggcggcacgaagagcgagcgcctg
aagcagttcctgtcgggcagcctcaagtaa

DBGET integrated database retrieval system