KEGG   Burkholderia thailandensis MSMB121: BTI_172Help
Entry
BTI_172           CDS       T02644                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00250  Alanine, aspartate and glutamate metabolism
btd00330  Arginine and proline metabolism
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTI_172
   00330 Arginine and proline metabolism
    BTI_172
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:btd03000]
    BTI_172
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BTI_172
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BTI_172
Transcription factors [BR:btd03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BTI_172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AGK46322
Position
1:194070..197999
Genome map
AA seq 1309 aa AA seqDB search
MASTTLGVKVDDLLRSRLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGAA
DLSDSHADGDEDGAPHPFLEFAQNVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASL
APDVQSMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDAL
IRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLI
RKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASY
EQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMVELLPRVRSLALLARRYD
IGLNIDAEEADRLEPSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRS
RHRLMIRLVKGAYWDTEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQF
ATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHE
TLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPLDEAAKVVPLGAPHEKIPLPREL
YGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDVLEHAAPRDVRNPADLR
DIVGTVSEATPEEVGAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVR
EAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVA
AALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADSRTRA
VMFTGSTEVARLINKTLSSRLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSF
DSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSADVGPVIDADAKRTIDA
HIAAMKDKGHAVTQLAMPDACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLD
KLLEQIRATGYGLTLGIHTRIDETIAHVISHAHVGNIYVNRNVIGAVVGVQPFGGEGLSG
TGPKAGGALYLPRLLATRPAGLPRSLEASLVADAPQEGETRDNPSAALTALRDWLIEQRE
PALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAVLAT
GNRALFAGAAGEALAAALPASLKAQAGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPG
PIVSVQGVAASAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaccacactgggcgtcaaagtcgacgatctgctccgctcgcgtctgaaggac
gcggcgtcgcggctcgagcgcactcctcactggctgatcaagcaggcgatcttcgcgtat
ctcgagcggatcgagcacggtcagcttccgccggagctgtccggccacacgggcgccgcc
gacctgtccgacagccacgccgacggcgacgaagacggcgcgccgcacccgttcctcgaa
ttcgcgcagaacgtgcagccgcaatcggtgctgcgcgcggcgatcacggccgcgtaccgc
cgcccggagcccgagtgcgtgccgttcctgatcggcgaggcgcggctgcccgcgagcctg
gcgccggacgtccagtcgatggcggcgggcctcgtcgaggcgctgcgcgagaagagctcg
ggcggcggcgtcgaggggctgatccacgaattctcgctgtcgagccaggaaggcgtcgcg
ctgatgtgcctcgccgaggcgctgctgcggattcccgaccgcgcgacccgcgacgcgctg
atccgcgacaagatcagcaagggcgactggcgctcgcacgtcggccacgcgccgtcgctg
ttcgtcaacgcggccacctggggcctgatgatcacgggcaagctcgtcacgacgaacagc
gaagcgggcctgtcgtcggcgctcacgcggctgatcggcaagggcggcgagccgctcatc
aggaagggcgtcgacatggcgatgcgcctgatgggcgagcagttcgtcacgggcgagacg
atctccgaagcgctcgcgaacagccgcaagtacgaggcgcgcggcttccgctactcgtac
gacatgctcggcgaggcggcgacgaccgaagaggacgcgctgcgctactacgcgtcgtac
gagcaggcgatccacgcgatcggcaaggcggcgggcggccgcggcatctacgaaggcccg
ggcatctcgatcaagctgtcggcgctgcacgcgcgctactcgcgctcgcagcaggaacgc
acgatggtcgagctgctgccgcgcgtgcgctcgctcgcgctgctcgcgcgccgttacgac
atcggcctgaacatcgatgccgaggaggcggaccggctcgagccgtcgctcgatctgctc
gaggcgctgtgcttcgatccggagctcgccggctggaacggcatcggcttcgtcgtgcag
gcgtaccagaagcgctgcccgttcgtgatcgactacctcgtcgacctcgcgcgccgcagc
cgccatcgcctgatgatccgcctcgtgaagggcgcgtactgggataccgagatcaagcgc
gcgcaagtggacggcctcgaaggctatccggtctacacgcgcaagatctacacggacgtg
tcgtacctcgcgtgcgcgaagaagctgctcgccgcgcccgacgccgtctatccgcagttc
gcgacgcacaatgcttacacgctcgccgcgatctatcacctcgcgggccagaactactac
cccggccagtacgaattccagtgcctgcacgggatgggcgagccgctgtacgaggaagtc
accggccgcgacaagctgaaccgcccgtgccgcgtgtatgcgcccgtcggcacgcacgag
acgctgctcgcgtacctcgtgcgccgcctgctggaaaacggcgcgaacacgtcgttcgtg
aaccgcattgccgacaagaccgtgtcggtgaaggagctggtcgccgatccgctcgacgaa
gccgcgaaggtcgtgccgctcggcgcgccgcacgagaagatcccgctgccgcgcgagctg
tacggcgcgtcgcgcgtcaattcgatgggcctcgatctgtcgaacgagcaccggctcgcg
tcgctgtcgtcggcgctgctcgcgagcgcgcatcatccgtggcgcgccgcgccgatgctc
gccgacgacgtgctcgagcacgccgcgccgcgcgacgtgcgcaatccggccgatctgcgc
gacatcgtcggcacggtcagcgaggcgacgcccgaagaggtgggcgcggcgctcgcgcac
gcggtcgcggccgcgccgatctggcaggcgacgcccgtcgacgcgcgcgccgattgcctc
gcgcgcgcggcggatcttctcgaagcgcagatgcacacgctgatgggcctgatcgtgcgc
gaggcgggcaagtcgctgccgaacgcgatcgccgagatccgcgaggcggtcgatttcctg
cgctactactcggcgcagatccgcgacgagttctcgaacgacacgcatcgcccgctcggc
cccgtcgtctgcatcagcccgtggaacttcccgctcgcgatcttcatgggccaggtggcg
gccgcgctcgcggcgggcaacacggtgctcgcgaagccggccgagcagacgcccctcatc
gccgcgcaggcggtgcgcctgctgcgcgacgccggcgtgccggcgggcgcggtgcaactg
ctgccgggcaacggcgagacggtcggcgcggcgctcgtggcggactcccgcacgcgcgcg
gtgatgttcaccggctcgaccgaagtcgcgcgcctcatcaacaagacgctgtcgtcgcgc
ctcgatccggacggcaagccgattccgctgatcgccgagacgggcggccagaacgcgatg
atcgtcgattcgtcggcgctcgccgagcaggtcgtcgccgacgtgctgcagtcgtcgttc
gactcggccggtcaacgctgttcggcgctgcgcgttctctgtctgcaggacgacgtcgcg
gaccgcacgctgacgatgctcaagggcgcgatgcgcgagctcgcgctcggcaatccggac
cggctgtcggcggacgtcggcccggtgatcgacgccgacgcgaagcgcacgatcgacgcg
cacatcgcggcgatgaaggacaaggggcacgcggtcacgcagctcgcgatgccggacgcg
tgcgcgcaaggcacgttcgtgccgccgacgatcatcgagatcggcaacgtcgacgagctc
aagcgcgaagtgttcggcccggtgctgcacgtcgtgcgctatcgccgcagcggcctcgac
aagctgctcgagcagatccgcgcgacgggctacggcttgacgctcggcatccacacgcgg
atcgacgagacgatcgcgcacgtgatctcgcacgcgcacgtcggcaacatctacgtgaac
cgcaacgtgatcggcgcggtggtcggcgtgcagccgttcggcggcgaagggctgtcgggc
acggggccgaaggcgggcggcgcgctctatctgccgcgcctgctcgcgacgcgcccggcc
gggctgccgcgctcgctcgaggcgtcgctcgtcgccgacgcgccgcaggaaggcgagacg
cgcgataatccgtccgccgcgctgaccgcgctgcgcgactggctgatcgagcagcgcgag
ccggcgcttgccgcgcgctgcgacggctacctgtcgcacgtgctcgcgggcgcaaccgcc
gtgctctcggggccgacgggcgagcgcaatacgtatacgctcggcgcgcgcggcacggtg
ctgtgcatcgcggcgacggcgagcggcgcgcgcgcgcagttcgcggcggtgctcgccacg
ggcaaccgcgcgctcttcgcgggcgcggcgggcgaggcgctcgccgcggcgctgccggca
tcgctgaaggcgcaggcgggcgtgaggaagcaggcggacgcggcgttcgacgcggtgctg
ttcgaaggcgacagcgacgagctgctcgcgctcgtgaaggaagtcgcgcagcgcccagga
ccgatcgtgtcggtgcagggcgtcgcggcgagcgcgttcgagaacggcggcgacgaggac
tacgcgcttgagcggctcctcaccgagcgctcggtgagcgtgaacaccgcggcggcaggc
ggcaatgcgaatttgatgacgattggctga

DBGET integrated database retrieval system