KEGG   Burkholderia thailandensis MSMB121: BTI_1836Help
Entry
BTI_1836          CDS       T02644                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase family protein
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00010  Glycolysis / Gluconeogenesis
btd00071  Fatty acid degradation
btd00350  Tyrosine metabolism
btd00625  Chloroalkane and chloroalkene degradation
btd00626  Naphthalene degradation
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01120  Microbial metabolism in diverse environments
btd01130  Biosynthesis of antibiotics
btd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTI_1836
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTI_1836
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BTI_1836
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTI_1836
   00626 Naphthalene degradation
    BTI_1836
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTI_1836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Lamprin
Motif
Other DBs
NCBI-ProteinID: AGK48482
Position
1:1986381..1986824
Genome map
AA seq 147 aa AA seqDB search
MEARAAMCYAQYLAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNAILLPHVSEFNLIAA
PERFATVASLLSVNTAGLSTVDAARAAIAAIRGLSASIGIPAGLVALGVKAEDHEVMASN
AQKDACMLTNPRKATLAQVIAIFEAAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcgcgcggcgatgtgctatgcgcagtatctcgccgggatggcgttcaacaac
gcgtcgctcggctatgtgcacgcgatggcgcaccagctcggcggtttctacaacctcccg
cacggggtctgcaatgcgatcctgctgccgcacgtgtccgagttcaacctgattgccgcg
cctgaacgcttcgccaccgtcgcgtcgctcctcagcgtcaatacggcaggcttgagcacc
gtcgacgccgctcgggccgccattgcggcgatccgcgggctctcggcatcgatcggcatc
ccggccggcctggtcgcgttgggcgtcaaggccgaagaccacgaggtgatggcgagcaat
gcgcagaaagacgcatgcatgctgaccaatccgcgcaaggcgacgctcgcccaggtcatc
gcgatcttcgaggcggcgatgtga

DBGET integrated database retrieval system