KEGG   Burkholderia thailandensis MSMB121: BTI_2306Help
Entry
BTI_2306          CDS       T02644                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00020  Citrate cycle (TCA cycle)
btd00310  Lysine degradation
btd00380  Tryptophan metabolism
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01120  Microbial metabolism in diverse environments
btd01130  Biosynthesis of antibiotics
btd01200  Carbon metabolism
Module
btd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTI_2306 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BTI_2306 (sucB)
   00380 Tryptophan metabolism
    BTI_2306 (sucB)
Enzymes [BR:btd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BTI_2306 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGK48021
Position
1:complement(2523842..2525119)
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAPAPAAQPAAAAASSAA
AASPAASKLMAEKGIGAADVAGSGRDGRITKGDVLSAGSAPKAAAAPAQALAAAKPSLPE
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQMSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcacaagacgaaatcctgatcgagctc
gagaccgacaaggtcgtcctcgaagtgccggcgcccgccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgacgatcgacaccgaa
gcgaaggcgggcgcggccgaagccgcggcaggcgccgccgaagtcaagccggccgccgct
cccgccgccgcgccggcgcccgccgcgcagccggctgccgccgccgcgtcgagcgccgcg
gccgcatcgcccgccgcatcgaagctgatggccgagaagggcatcggcgcggccgacgtc
gcaggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcg
ccgaaggccgcggcggcccccgcgcaggcgttggccgcggcgaagccgtcgctgccggaa
gtgaaggtgccggcgtcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccg
atgtcgcgcctgcgcgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctgacgacgttcaacgaagtgaacatgcagcccgtgatggatctgcgcgcgaagtac
aaggacaagttcgagaaggaacacggtgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtccacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgac
atcgtctatcacggctatttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtc
gtgccgatcctgcgcaacgcggatcagatgagcctcgccgacatcgagaagaagatcgcc
gaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggcacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcatgcgacgaaggaacgtccggtcgtcgagaacggc
cagatcgtgatccgtccgatcaactatctcgcgctgtcgtatgaccaccggatcatcgac
ggccgcgaagcggtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system