KEGG   Burkholderia thailandensis MSMB121: BTI_3164Help
Entry
BTI_3164          CDS       T02644                                 

Definition
(GenBank) alpha/beta hydrolase fold family protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00903  Limonene and pinene degradation
btd00930  Caprolactam degradation
btd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTI_3164
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BTI_3164
Enzymes [BR:btd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BTI_3164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: AGK46394
Position
1:complement(3496502..3497467)
Genome map
AA seq 321 aa AA seqDB search
MSWQSKVACWLLRRQFHPETQRPVIDPARARRLTKLRMRVPRRPPAGWRLRERYGAGDAP
LRGEWLERADAMPGRAQHSRMLLYFHGGGYYFCSPQTHRPLVFALTKHAGVRSFSLDYRL
APEHPFPAALNDALAAYRQLVSAGTPPESIVFGGDSAGGGLALAALVALRDAGDPLPAGA
VLFSPWTDLAATGDTLRSHDGLDPMFAGAALGRAARLYLGDTPGTHPHASPLYADFTGLP
PLFIQAGSTEVLLDDSRRVADKARAAGVHVELEIWPQMPHVWQIYVPFVPESARALVRAA
AFVRRIAVERATQRTADASIA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcagagcaaagtggcgtgctggctgctgcgccggcagtttcatcccgagacg
cagcgtcccgtgatcgatccggcgcgcgcgcggcggctgacgaagctgcggatgcgcgtg
ccgcgccgtccgcccgccggctggcggctgcgcgagcgttacggcgccggcgacgcgccg
ctgcgcggcgaatggctcgagcgcgcggacgccatgccgggccgcgcgcagcacagccgg
atgctgctgtatttccacggtggcggttattacttctgctcgccgcagacgcaccgcccg
ctcgtgttcgcgctgacgaagcacgccggcgtgcgctcgttctcgctcgactatcggctc
gcgcccgagcatccgtttccggccgcgctgaacgacgcgctcgccgcgtaccggcaactc
gtgtccgccggcacgccgccggagtcgatcgtgttcggcggcgattcggcgggcggcggc
ctcgcgctcgcggcgctcgtcgcgctgcgcgacgcaggcgacccgctgcccgcgggcgcc
gtgctgttctcgccctggaccgatctcgccgcgacgggcgacacgctgcgctcgcacgac
gggctcgacccgatgttcgcgggcgcggcgctcggccgcgcggcgcgcctgtatctcggc
gacacgccgggcacgcatccgcatgcgtcgccgctgtacgcggatttcacgggattgccg
ccgctcttcatccaggcgggcagcaccgaggtgctgctcgacgattcgcggcgcgtcgcc
gacaaggcgcgcgcggcgggcgtgcacgtcgaactggagatatggccgcagatgccgcac
gtctggcagatctatgtgccgttcgtgcccgaatcggcgcgcgcgctcgtgcgcgcggcc
gcgttcgtgcggcgcatcgcggtcgagcgcgcgactcagcgcacggcagacgcgtcgatc
gcctga

DBGET integrated database retrieval system