KEGG   Burkholderia thailandensis MSMB121: BTI_3529Help
Entry
BTI_3529          CDS       T02644                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00053  Ascorbate and aldarate metabolism
btd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BTI_3529
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     BTI_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 NAD_binding_10 Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: AGK48364
Position
1:complement(3891451..3892320)
Genome map
AA seq 289 aa AA seqDB search
MTDLQHSNQDASAAGDDPLDGVVTHCGRILLTGAAGNLGRVLRERLRRYADVVRVSDVAP
LGDARAGEECVRCDLADAAAVDALVRDVDVIVHFGGVSAEHPFDTVLPANIAGTYHVYEA
ARRHGVRRIVFASSNHVTGFYEQGERIDTAALPRPDGYYGLSKAFGEQLARFYQDRYGIE
SVCIRIGSSFPEPKDRRMLVTWLGYDDLEQLVRRAMFVPRVGCTIVYGMSANRDAWWDNA
HAAHLGYRPTQSSEPWRESIEHTLPPLADDDPVRRYQGGAFVAAGPFGG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctccagcattcgaaccaagatgcgagcgcggcgggcgacgacccgctcgac
ggcgtcgtcacccactgcggccgcatcctgctcacgggcgcggccggcaatctcggccgc
gtgctgcgcgagcggctgcgccgctacgcggatgtcgtgcgcgtctccgacgtcgcaccg
ctcggcgacgcgcgcgccggcgaagagtgcgtgcgctgcgacctcgccgacgcggcggct
gtcgacgcgctcgtgcgcgacgtcgacgtgatcgtgcatttcggcggcgtgtcggccgag
catccgttcgacaccgtgctgcccgcgaacatcgcgggcacgtatcacgtgtacgaagcc
gcgcgccggcacggcgtgcgccgcatcgtgttcgcgagctcgaatcacgtgacgggcttc
tacgagcagggcgagcgcatcgacacggccgcgctgccgcggcccgacggctactacggt
ttgagcaaggcgttcggcgagcagctcgcgcggttctatcaggatcgctacggaatcgag
agcgtgtgcatccggatcggctcgtcgttccccgagccgaaggatcggcggatgctcgtc
acgtggctcggctacgacgacctcgagcaactcgtgcgccgcgcgatgttcgtgccgcgc
gtcggctgcacgatcgtctacgggatgtcggcgaaccgcgatgcgtggtgggacaacgcg
cacgccgcgcatctcggctaccggccgacgcaatcgagcgagccgtggcgcgaatcgatc
gagcacacgctgccgccgcttgccgacgacgatccggtgcgccgctatcagggcggcgcg
ttcgtcgccgccggaccgttcggaggctga

DBGET integrated database retrieval system