KEGG   Burkholderia thailandensis MSMB121: BTI_357Help
Entry
BTI_357           CDS       T02644                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:btd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BTI_357 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:btd03011]
    BTI_357 (rplV)
Ribosome [BR:btd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BTI_357 (rplV)
  Bacteria
    BTI_357 (rplV)
  Archaea
    BTI_357 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AGK48197
Position
1:401989..402318
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaagacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggctggcatcgtgaagaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgatatcgacgagctcaagatcaagagcatctacgtcgacaaggccgcg
tcgctcaagcgtttcaccgcgcgcgcgaaaggccgcggcaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system