KEGG   Burkholderia thailandensis MSMB121: BTI_3905Help
Entry
BTI_3905          CDS       T02644                                 

Definition
(GenBank) HAD hydrolase, IA, variant 3 family protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00010  Glycolysis / Gluconeogenesis
btd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTI_3905
Enzymes [BR:btd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     BTI_3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AGK49928
Position
2:complement(366853..367467)
Genome map
AA seq 204 aa AA seqDB search
MTPPIKLVLFDMEGVLSTYDRAARTARLADLTGRPPDAVRHAIWESGLEARADAGLIGVD
QYLSELAELLGAPVSRDDWLIARRASITPNLDVVALAERVAQRSRIAVLTNNCRLVTDYI
DYLNPPVARVFGADVYPSATFGAAKPDAQAYLGCVGWLGAAADETLFIDDADANVEGAVR
AGLLGCKFVGAEALADELARRRLI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgccgatcaagctggtgctgttcgacatggagggcgtgctgtcgacttacgac
cgcgccgcccgcaccgcgcgcctcgccgacctgacggggcggccgcccgacgcggtgcgc
cacgcgatctgggaatcgggcctcgaagcgcgcgccgacgcggggctcatcggcgtcgac
caatacctgagcgagctcgccgaactgctcggcgcgccggtgagccgcgacgactggctg
atcgcgcgcagggcgtcgatcacgccgaacctggacgtcgtcgcgctggccgagcgcgtt
gcgcagcgcagccggatcgcggtgctgacgaacaactgcaggcttgtcaccgattacatc
gattatctgaatccgcctgttgcgcgcgtgttcggcgcggacgtttatccgtcggcgacg
ttcggcgcggcgaagccggatgcgcaggcttatctcggctgcgtcgggtggctcggcgcg
gcggcggacgagacgctcttcatcgatgacgccgatgcgaacgtcgagggcgcggtgaga
gcggggctgctggggtgcaagttcgtgggtgcggaagcattggccgacgagttggcgcgg
cggcggctgatttag

DBGET integrated database retrieval system