KEGG   Burkholderia thailandensis MSMB121: BTI_3980
Entry
BTI_3980          CDS       T02644                                 

Definition
(GenBank) transcriptional regulatory, C terminal family protein
  KO
K02483  two-component system, OmpR family, response regulator
Organism
btd  Burkholderia thailandensis MSMB121
Brite
KEGG Orthology (KO) [BR:btd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:btd02022]
    BTI_3980
Two-component system [BR:btd02022]
 OmpR family
  Unclassified
   BTI_3980
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: AGK50635
Position
2:complement(451180..451914)
AA seq 244 aa
MNATRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAADSVERREYEMVLLDLGL
PDGDGIDVLLRWRDSQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRAL
WRRAEPSTTPVRRGRHPRAYRFDGWTLNMNTRRLSTRDAQDVPLTVGEFNLLAFFLGSPS
RVVTRAQLLECTRAFDDVFDRAVDVQIWRLRKKIEKNPKHPELIRTERGVGYYFAATNVE
TLWE
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaatgcgacaagatcgccggcggtgctcgtcgtcgaggacgacgagccgttgcggcgc
gtgctctgcaattacctgtcgggccacggcatggccgtggacggcgtggggacggcagcc
gcggccgccgattcggtcgagcggcgcgaatacgaaatggtgctgctcgacctcggtttg
ccggatggagacggcatcgacgtgctgctgcgctggcgcgattcgcagcgctttccgctc
atctgcgtgacgggccgaagcgaagaggccgatcgcatcatgggcctcgaattcggcgcg
gacgattacgtcgtgaagccgtactcgctgcgcgaggtgctcgcgcggatgcgcgcgctg
tggcggcgcgccgagccgtcgacaacgcccgtgcggcgcggcaggcatccgcgcgcatac
cgtttcgacggctggacgctgaacatgaacacgcgccggctgtcgacgcgcgacgcgcag
gacgttccgctgacagtcggcgaattcaatctgctggcgttttttctcggctcgccgtcg
cgcgtcgtcacgcgtgcgcagttgctcgagtgcacgcgcgcgttcgacgacgtgttcgat
cgcgcggtcgacgtgcagatctggcggctgcgcaagaagatcgagaagaatccgaagcat
cccgaactgattcgaacggagcgcggcgtcggctactacttcgccgcgacgaacgtggag
acgctatgggaatga

DBGET integrated database retrieval system