KEGG   Burkholderia thailandensis MSMB121: BTI_3981
Entry
BTI_3981          CDS       T02644                                 

Definition
(GenBank) his Kinase A domain protein
Organism
btd  Burkholderia thailandensis MSMB121
SSDB
Motif
Pfam: HATPase_c MASE1 HisKA HATPase_c_3
Other DBs
NCBI-ProteinID: AGK49968
Position
2:complement(451911..453719)
AA seq 602 aa
MHENSIDAGPPARARPARIKQASRRAPRRGDRTFAPGGALNAAGLLLLLFYANHLLTRPG
ACTSLNHTLSAVVWPAPVLGIALLLHCRRPLAWGLGVVSLFVTLLAAGSLDWVPWRVDAL
FAAVNAIEAIAGAWLARRYVSPGGGVDTLRGFAMFVLLLPLGMAAMHATLAAVILSVWLN
DREWLNEWSRAYAANALALLALLPALLTWNARACRAAWSRSRNQLPALATFGSLCFASIW
GDQAEVARALLALSLCWAGIEGGLVLASQLNALAAIALIAMTLGGRGPYALHYDGHGVWA
LQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDFNNVLTTIDCHA
EYASDRLADGARADESIDEIHRAVERGRDLTTQILLAARRGEPVLTRVSVDEVVDDALAA
MRAAALRGIEIVRCGDDACGDARRDDARHVVFADRSQLARAVMNLVGNAVRAARATVVVR
VGANDGGAPAADAFDVAIGEPSVPGGVWIEVSDDGDGIGVEPLDRIFEPFYSNRSGAPGT
GLGLAIVAGAAIAHRGQIAVATDRGAGSRFRLTLPAAHGTGASGAPGEADAGARGAVQEK
KR
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgcacgaaaattccatcgatgccggcccgcccgcgcgcgcccggcccgcacgcatcaag
caggcgtcgcgccgcgcgccgcgccgcggcgatcgcacattcgcgccgggcggcgcgctg
aacgcggcggggctgctgctgctgctgttctacgcgaatcatctgctgacgcggccgggc
gcatgcacgtcgctcaatcacacgctgtcggccgtcgtgtggcccgccccggtactgggc
atcgcgttgctgctgcattgccggcggccgctcgcgtgggggctcggcgtggtttcgctg
ttcgtcacgctgctcgccgcgggctcgctcgattgggtgccgtggcgcgtcgacgcgctg
ttcgcggccgtcaacgcaatcgaggcgatcgcgggcgcgtggctcgcgcggcgctacgtg
agcccgggcggcggcgtggacacgctgcgcggcttcgcgatgttcgtgctgctgttgccg
ctcggcatggcggcgatgcatgcgacgctcgcggcggtgatcctgtctgtgtggctgaac
gatcgcgagtggctgaacgaatggtcgcgtgcgtatgcggcaaacgcgctcgcattgctc
gcgttgcttccggcgcttctcacgtggaacgcgcgcgcttgccgcgcggcgtggtcgcgc
agccggaatcagttgcccgcgctcgcgaccttcggttcgctgtgcttcgcatcgatatgg
ggcgaccaggccgaggtcgcgcgcgcgttgctcgcgctgtcgttgtgctgggccgggatc
gagggcggtctcgtgctcgcgtcccaactcaacgcactcgcggcgatcgccctgatcgcg
atgacgctcggcggccgcgggccgtatgcattgcattacgacggtcacggcgtctgggcg
ctgcaggtcgatctgatcggcgtcgcgatcctgtcgatgtgcatcgcgatcgcgacgggc
gagcgacgccggctcgcgcggcagatcgagcgatcgcgcaggttcgagtcgctcggcttc
ttcgcgggcgggatcgttcacgacttcaacaacgtgctgacgacgatcgattgccatgcc
gaatatgcctcggatcggctggcggacggtgcgcgcgcggacgagtcgatcgacgaaatt
catcgcgcggtcgagcgggggcgcgatctgacgacgcagatcctgctcgccgcgcgccgc
ggcgaacccgtgctgacgcgggtgagcgtcgacgaggtcgtcgacgacgcgctcgccgcg
atgcgcgcggccgccctgcgcggcatcgagatcgtccggtgcggcgatgacgcgtgcggc
gacgcgcggcgtgacgacgcccgtcacgtcgtattcgccgatcgcagccagctcgcgcgc
gcggtcatgaatctcgtcggcaacgcagtgcgcgcggcgcgcgcgacggtcgtcgtgcgt
gtcggtgcgaacgacggcggcgcgccggccgccgatgcattcgatgtcgcgatcggcgag
ccgtcggtgccgggcggcgtatggatcgaggtgagcgacgacggcgacggcatcggcgtc
gagccgctcgaccgcatcttcgagccgttctattcaaaccggtccggcgcgccgggcacg
gggctcggcctggcgatcgtcgcgggcgcggcgatcgcgcatcgcgggcagatcgccgtc
gcgacggatcgcggcgcgggcagccgcttcaggctcacgttgcccgcggcgcacgggacg
ggcgcgtcgggcgcaccgggagaagcggacgccggcgcgcgcggcgcagtacaggagaag
aaacgatga

DBGET integrated database retrieval system