KEGG   Burkholderia thailandensis MSMB121: BTI_4669Help
Entry
BTI_4669          CDS       T02644                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00562  Inositol phosphate metabolism
btd00564  Glycerophospholipid metabolism
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BTI_4669
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BTI_4669
   00565 Ether lipid metabolism
    BTI_4669
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BTI_4669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:btd02042]
    BTI_4669
Enzymes [BR:btd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BTI_4669
Bacterial toxins [BR:btd02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BTI_4669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AGK51342
Position
2:complement(1353286..1355481)
Genome map
AA seq 731 aa AA seqDB search
MNSRRRFLQGAASTGIAAATLAAFPPSIRRALAIPANNRTGTIRDVEHIVILMQENRSFD
NYFGTLRGVRGFGDRFGIPLPNAPTVWQQRNAAGAPVLPYHLDGSKGNAQRVSGTPHSWD
DGQNAWDGGRMYQWPRYKNTASMGYFRESELPFQFALANAFTICDAYHCSMHAGTNSNRL
FMWTGTNGPTGAGVASVVNEWDDIGPSTLGYEWKTYPERLQEAGVSWKVYQNMPDNFTDN
SLAGFKQYRRANEASGKPVSNSDKVVSPAYDPASDDVRNPLYKGIANTMPDGGFLGAFKE
DVRNGKLPQVSWVVAPAAYSEHPGPSSPVQGAWYIQETLDALTAMPDVWSKTVLLVNFDE
NDGYFDHVPSPSAPSLNPDGTPAGKTTLSDADIAFERFTHPKPPGTKSQPQPDARVYGPG
VRVPMYVISPWSRGGWVNSQVFDHTSTLRFIEARFGVREPNISAFRRAVCGDLTSAFNFV
QPNDEPLPTLAGRKTQAQADALRAAQQQMPQIVPPANGQLPRQAAGTRPSRALPYELHVN
AVAGTLDGTLRLVFANTGQAAAVFHVYDKLNLGRLPRRYTVEAGRQLDDVWAAMTDNAGK
YDLWVLGPNGFHRHFTGDLNRLRAGGAPAPEVRVEYDRKHGNVQLLLRNEGARECVFTVR
AKAYRNDGPWTFKVKGGAERKHHWKLDDSGNWYDFVVTCDADAGYARRFAGRVETGEHSV
SDPAMGMGDRF
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcgccgcagatttctgcaaggcgccgcatccaccggcatcgcggccgccacg
ctggccgcgttcccgcccagcattcgccgcgcgctcgccattcccgccaacaaccggacc
ggcaccattcgggatgtcgagcacatcgtcatcctgatgcaggaaaaccgctcgttcgac
aactacttcggcacgctgcgcggcgtgcgcggcttcggcgaccgcttcggcattccgctg
cccaacgcgccgacggtctggcagcagcgcaacgcggcgggcgcgccggtattgccgtac
cacctggacggcagcaagggcaatgcgcagcgcgtgagcggcacgccgcactcgtgggac
gacggccagaatgcgtgggacggcgggcgcatgtaccagtggccgcgctacaagaacacg
gcatcgatgggttacttccgggagagcgagctgccgttccagttcgcgctcgcgaatgcg
ttcacgatctgcgacgcctaccactgctcgatgcacgcgggcaccaactccaaccgcctg
ttcatgtggaccggcaccaacggcccgaccggcgcgggcgtggcctcggtggtgaacgaa
tgggacgacatcggtccttccacgctcggctacgagtggaagacctatcccgagcgcctg
caggaagccggcgtgagctggaaggtctaccagaacatgcccgacaacttcaccgacaac
tcgctcgccggcttcaagcaataccggcgcgcgaacgaggcgtcgggcaagccggtgagc
aacagcgacaaggtggtttcgcccgcgtatgatccggcgagcgacgacgtgcgcaacccg
ctgtacaagggcatcgccaacacgatgcccgacggcggttttctcggcgctttcaaggaa
gacgtccgcaacggcaagctgccgcaggtgtcgtgggtggtggcgccggccgcgtattcc
gagcaccccggcccgtcgagcccggtgcagggcgcgtggtacatccaggagacgctcgat
gcgctcaccgcgatgcccgacgtctggagcaagaccgtgctgctcgtgaacttcgacgag
aacgacggctacttcgaccacgtgccttcgccgtcggcgccgtcgctgaacccggacggc
acgccggccggcaagaccacgctgtccgacgccgacatcgcgttcgagcgcttcacccac
ccgaagccgccgggcaccaagagccagccgcagcccgacgctcgcgtgtatggccccggc
gtgcgcgtgccgatgtacgtgatctcgccgtggagccgcggcggctgggtcaactcgcag
gtattcgaccacacgtcgaccctgcgcttcatcgaggcgcgcttcggcgtgcgcgagccc
aacatctccgcgttccgccgcgcggtatgcggcgatctgacgagcgccttcaacttcgtg
caaccgaacgacgagccgctgcccacgctcgccggccgcaagacccaggcccaggccgat
gcgctgcgcgccgcgcagcagcagatgccgcagatcgtgccgcccgcgaacggccagttg
ccgcgccaggcggcgggcacgcggccttcgcgcgcattgccgtacgagctgcacgtcaat
gccgtcgccgggacgctcgacggcacgctgcgcctcgtattcgccaacacgggtcaggcc
gcggccgtgttccacgtctacgacaagctgaatctgggccgcctgccgcgccgctacacg
gtcgaggccggcaggcagctcgatgacgtgtgggccgccatgaccgacaacgccggcaag
tacgacctgtgggtgctcgggcccaacggctttcaccgccacttcaccggcgacctgaac
cgcttgcgcgcgggcggcgctcccgcacccgaagtgcgggtggagtacgacaggaagcac
ggcaacgtgcaattgctgttgcgcaacgaaggggcgcgcgagtgcgtgtttaccgtgcgc
gcgaaggcgtaccgcaacgatggcccgtggaccttcaaggtcaagggcggcgccgagcgc
aagcaccactggaagctggacgacagcggcaactggtacgacttcgtcgtgacctgcgac
gccgacgccggctacgcgcgccgctttgccggccgggtggaaaccggcgagcattccgtc
agcgatccggcgatgggaatgggcgaccggttctga

DBGET integrated database retrieval system