KEGG   Burkholderia thailandensis MSMB121: BTI_5185Help
Entry
BTI_5185          CDS       T02644                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00360  Phenylalanine metabolism
btd00362  Benzoate degradation
btd00620  Pyruvate metabolism
btd00621  Dioxin degradation
btd00622  Xylene degradation
btd00650  Butanoate metabolism
btd01100  Metabolic pathways
btd01120  Microbial metabolism in diverse environments
btd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTI_5185
   00650 Butanoate metabolism
    BTI_5185
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BTI_5185
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTI_5185
   00622 Xylene degradation
    BTI_5185
   00621 Dioxin degradation
    BTI_5185
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BTI_5185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh Glu_dehyd_C Shikimate_DH DapB_N
Motif
Other DBs
NCBI-ProteinID: AGK50096
Position
2:1950804..1951697
Genome map
AA seq 297 aa AA seqDB search
MKNKSSRTRVAILGSGSIGLDLMFKVKASEQFDLKFVVGRHANSEGLKLARSCNVETSSD
GLDFLKAHEDAYDLVFDATSAAAHKVNNRFFSDAGKFVIDLTPAKLGRLCVPCINLDDIG
AEQNVNLITCGGQASLPLAYALKQAVDEIEYLEVVSAIASRSAGIATRENIDEYMTTTEY
ALAKFSGAKKTKAILNINPAEPGVRMQTTLYAYARYRDFDRVRACVADMVEKVREYVPGY
RLVVEPIESQGRITISLTVRGRGDYLPEYAGNLDIINCAALAVASHRHATARLGATQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaagtcatcgcgcacgcgggtggcgatcctcgggtcgggcagcatcgggctc
gacctgatgttcaaagtcaaggcatccgaacaattcgatctgaaattcgtcgtcggacgc
catgcgaacagcgaggggctgaagctcgcacgtagctgcaacgtcgagacgtcgagcgac
ggcctcgacttcctgaaggcgcacgaggatgcgtatgacctcgtgttcgacgcgacgtcg
gccgcagcgcacaaggtcaacaaccgcttcttctccgacgcgggcaagttcgtgatcgat
ctgacgcctgcgaagctcggccgcctgtgcgtgccgtgcatcaatctggacgacatcggc
gccgagcagaacgtgaacctgatcacctgcggcgggcaggcgagcctgccgctcgcgtat
gcgctgaagcaggcggtcgacgagatcgaatacctggaggtggtgtcggcgatcgcgtcg
cgcagcgccggcatcgcgacgcgcgagaacatcgacgaatacatgacgacgaccgagtac
gcgctcgcgaagttcagcggtgcgaagaagacgaaggcgatcctcaacatcaatccggcc
gagcccggcgtgcggatgcagacgacgctctatgcgtacgcgcgctatcgcgatttcgac
cgcgtgcgcgcgtgcgtcgccgacatggtcgagaaggtccgcgaatacgtgcccggctac
cggctcgtcgtcgagccgatcgagagccagggaaggatcacgatcagcctcaccgtgcgc
gggcgcggagactatctgcccgagtacgcgggcaatctcgacatcatcaattgcgcggcg
ctcgcggtcgcctcgcatcggcacgcaaccgccagactaggagccacacaatga

DBGET integrated database retrieval system