KEGG   Burkholderia thailandensis MSMB121: BTI_5393Help
Entry
BTI_5393          CDS       T02644                                 

Definition
(GenBank) peptidase M20/M25/M40 family protein
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
btd  Burkholderia thailandensis MSMB121
Brite
KEGG Orthology (KO) [BR:btd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:btd01002]
    BTI_5393
Enzymes [BR:btd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     BTI_5393
Peptidases and inhibitors [BR:btd01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   BTI_5393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AGK51625
Position
2:complement(2229940..2231166)
Genome map
AA seq 408 aa AA seqDB search
MSKLQHVAAAVCGALCASAAHAAPVWITLAAPALRELRAIDPAATSRYSAALATGDAKRT
ETVHVAQVDDSLLESLSQAIRRARGHGPGFFVHATFDEARASLQPSAAMQAAAIDYPITN
SQQVRNWISQLQASNIVSTIVSLSGFTNRYYTTSHGVAASDWIAQQWKQLAGSRTDVTVE
QFAHTGWPQKSVILTIKGSDPAAGVVVIGGHLDSTVGRMSENTRAPGADDDASGIASLTE
ALRVLLANRYQPKRTLKFIGYAAEEPGLLGSQAIAKQFRAQNVNVVGAFQLDMTNYKGDP
KDIYLISDYTNSTQNTYLANLAKTYLPELAVGTSQCGYACSDHASWNAQGYPASFPFEAD
QNDNPYIHSAYDTLDRSDSQGNHALKFGKLALAYAAELGGGLSASAKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagctccaacacgtcgccgccgcggtctgcggcgccctctgcgcatcggccgcc
cacgccgcgccggtgtggatcacgctcgccgcccccgccttgcgcgaactgcgcgcgatc
gatcccgccgcgacgagccgctacagcgcggcgctcgccaccggcgacgcgaagcgcacc
gaaacggtccacgtcgcgcaggtcgacgattcgctgctcgaatcgctgtcgcaggcgatc
cgccgcgcgcgcggccacggccccggcttcttcgtgcacgcgacgttcgacgaagcgcgc
gcgtcgctgcagccgagcgccgcgatgcaggcggccgcgatcgactacccgatcaccaac
tcgcaacaggtccgcaactggatctcgcaactgcaggcgagcaacatcgtcagcacgatc
gtgtcgctgtccggcttcacgaaccgctattacacgacgtcgcacggcgtggccgcgtcc
gactggatcgcgcagcaatggaagcagctcgccggctcgcgcaccgacgtgacggtcgag
cagttcgcgcacaccggctggccgcaaaaatcggtgatcctgacgatcaagggcagcgat
ccggcggcgggcgttgtcgtgatcggcggccatctcgattcgacggtcggccgcatgagc
gagaacacgcgcgcgccgggcgcggacgacgatgcatccggcatcgcgagcctcaccgaa
gcgctgcgcgtactgctcgcgaaccgctatcagccgaagcgcacgctgaagttcatcggc
tatgcggcggaagagccgggcctcctcggctcgcaggcgatcgcgaagcagttcagggcg
cagaacgtgaacgtcgtcggcgcgttccagctcgacatgacgaactacaagggcgatccg
aaggacatctacctgatcagcgactatacgaactcgacgcagaacacgtatctcgcgaac
ctcgcgaaaacctatctgcccgagctcgcggtcggcacgtcgcaatgcggctatgcgtgc
tccgatcacgcgtcatggaacgcgcagggctatccggcgtcgttcccgttcgaagcggat
cagaacgacaatccgtacatccactccgcgtatgacacgctcgatcggtcggactcgcaa
ggcaatcacgcgctgaagttcggcaagctcgcgctcgcgtacgcggccgagctgggcggc
ggactcagcgcgtccgcgaagcggtaa

DBGET integrated database retrieval system