KEGG   Burkholderia thailandensis MSMB121: BTI_5736Help
Entry
BTI_5736          CDS       T02644                                 

Definition
(GenBank) amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00330  Arginine and proline metabolism
btd00360  Phenylalanine metabolism
btd00380  Tryptophan metabolism
btd00627  Aminobenzoate degradation
btd00643  Styrene degradation
btd01100  Metabolic pathways
btd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BTI_5736
   00360 Phenylalanine metabolism
    BTI_5736
   00380 Tryptophan metabolism
    BTI_5736
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTI_5736
   00643 Styrene degradation
    BTI_5736
Enzymes [BR:btd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BTI_5736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGK50363
Position
2:complement(2618731..2620188)
Genome map
AA seq 485 aa AA seqDB search
MKLSEYVDYDAVGLARLLARGDVGAAELARTAGEAIEAVNPAVNAVVEHWPADTAGPTAA
PGSGPLAGVPFLIKDLALPMAGKRMELGSRLAAGLVSPSDSMLMQRLRAAGLVTLGRTAT
PEMAFSTATESVQQGATRNPWNPAFSAGGSSGGAAAAVAAGIVPLAHATDAAGSIRVPAA
FTGLFGLKPTRGRVSNGPGLDEVFAGLGVQGGLSRTVRDSAALLDAMHGTAAGEPYHTSA
PARAFLSEVGRDPGRLRIGLMLQPFNGARAAPAMTQAASDTAGHLEKLGHAIEPMTPELG
VSWEAFVHANARIWCATLVGWIDGVAAATGRPVDGSTLEPATLAAYRYGKQVTGPDFADA
LTVRNAMTRSTADWFRRVDVLLSPTMPAPPEALGSYYAGAERMDGLQWTERLFRHSPYTP
AFNVAGLPAMSVPLFHDEAAGLPIGVQFGAGFAQEATLLRLAGQLEQTLPWRHRRPAVWA
GSRTA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagcgaatacgtcgattatgatgccgtcggactggcccggctgctcgcgcgc
ggcgacgtcggcgcggccgagctggctcgcacggccggcgaagcgatcgaagcggtcaat
cccgccgtcaatgcggtggtcgagcactggcccgccgacaccgcggggcccacggccgcc
cccggcagcggtccgctcgcgggcgtgccgttcctgatcaaggatctggcgctgccgatg
gcgggcaagcggatggagctcggttcgcggttggcggcaggactcgtgtcgccgtcggat
tcgatgctgatgcaacgcctgcgggcggccggcctcgtgacgctcggccgcaccgccacg
ccggagatggcgttcagcaccgcgaccgaatcggtgcaacaaggcgccacgcgcaatccg
tggaaccccgccttcagcgcgggcggctccagcggcggagcggcagccgccgtcgccgcc
ggcatcgtgccgctcgcccacgcgaccgacgcggccggatcgatccgggtgccggcggcc
ttcaccggcctcttcgggctgaaaccgacgcgcggccgggtttccaacgggccggggctc
gacgaagtcttcgccgggcttggcgtgcaaggcggcttgagccgcacggtgcgcgacagc
gccgcgctgctcgacgcgatgcacggcacggcggcaggcgagccgtatcacacgagcgcg
ccggcccgcgcgttcctgtccgaggtaggccgcgatccgggacggctgcgcatcggtctg
atgctgcaaccgttcaacggcgcgcgcgccgcgccggcgatgacgcaggcggcgtcggat
acggccggtcatctggaaaagctgggccacgctatcgaaccgatgacgcccgaactcggc
gtgtcatgggaagcgttcgtgcacgccaacgcgcggatatggtgcgccacgctcgtgggc
tggatcgacggcgtcgccgccgcgaccggcaggccggttgacggcagcacgctggagccc
gctacgctcgccgcataccgctacggcaagcaggtcaccgggccggacttcgcagacgcg
ctgacggtgcgcaatgcgatgacgcgcagcacggccgactggttccggcgcgtcgacgtg
ctgctgtcgccgacgatgccggctccgccggaagcgctcggcagctattacgccggcgcg
gaacggatggacggcctgcaatggaccgaacgcctgttccgccactcgccgtatacgccg
gccttcaacgtggcggggctgccggccatgtcggtgccgctcttccacgacgaggcggct
ggcctgccgatcggcgtgcagttcggcgccggcttcgcgcaggaagcgacgctgctgcgt
ctcgccgggcagctcgagcaaaccctgccgtggcggcaccgccggccggcggtgtgggcc
ggctcccgcacggcctga

DBGET integrated database retrieval system