KEGG   Burkholderia thailandensis E264: BTH_I0416Help
Entry
BTH_I0416         CDS       T00311                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00010  Glycolysis / Gluconeogenesis
bte00260  Glycine, serine and threonine metabolism
bte00680  Methane metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
bte01230  Biosynthesis of amino acids
Module
bte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bte_M00002  Glycolysis, core module involving three-carbon compounds
bte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_I0416
  Energy metabolism
   00680 Methane metabolism
    BTH_I0416
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTH_I0416
Enzymes [BR:bte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BTH_I0416
Membrane trafficking [BR:bte04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BTH_I0416
Exosome [BR:bte04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BTH_I0416
  Exosomal proteins of melanoma cells
   BTH_I0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABC37707
UniProt: Q2T1H5
Position
I:complement(463539..464291)
Genome map
AA seq 250 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNSEARQAGLLLKEAGYTFDIAYTSVLKR
AIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTP
PPALEPTDERAPYGDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSIRALVKYLDGISDADIVGLNIPNGVPLVYELDANLTPIRHYYLGDPEAIAKAQAA
VAQQGKASAA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacctggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacaaggcaacagcgaagcccggcaggccggg
ctgctcctgaaggaagccggctacacgttcgatatcgcatacacgtcggtgctcaagcgc
gcgatccgcacgctctggcacgttcaggaccagatggatctgatgtacgtgcccgtcgtc
cattcgtggcggctgaacgagcgtcattacggcgcgctgtcgggcctgaacaaggctgag
acggccgcgaagtacggcgacgagcaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgagcgcgcgccatacggcgatccgcgctacgcgaag
gtgccgcgcgagcaactcccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgaatcgatcgcgcccgcggtgaaggccggcaagcaggtgctgatcgcc
gcgcacggcaactcgatccgcgcgctggtcaagtatctcgacggcatttcggacgcggac
atcgtcggcctgaacattccgaacggcgtgccgctcgtctacgagctcgacgcgaacctc
acgcccatccggcactactacctcggcgacccggaagcgatcgcgaaggcgcaggccgcc
gtcgcgcagcagggcaaggcgtccgcggcgtaa

DBGET integrated database retrieval system