KEGG   Burkholderia thailandensis E264: BTH_I1282
Entry
BTH_I1282         CDS       T00311                                 

Gene name
katG
Definition
(GenBank) catalase/peroxidase HPI
  KO
K03782  catalase-peroxidase [EC:1.11.1.21]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00360  Phenylalanine metabolism
bte00380  Tryptophan metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BTH_I1282 (katG)
   00380 Tryptophan metabolism
    BTH_I1282 (katG)
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.21  catalase-peroxidase
     BTH_I1282 (katG)
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-ProteinID: ABC36439
UniProt: Q2SZ20
Position
I:1434054..1436240
AA seq 728 aa
MSNEAKCPFHHAAGNGTSNRDWWPDQLDLSALHRHSSLSDPMDRDFNYAQAFEKLDLAAV
KRDLHALMTTSQDWWPADFGHYGGLFIRMAWHSAGTYRTADGRGGAGEGQQRFAPLNSWP
DNANLDKARRLLWPIKQKYGRSISWADLLILTGNVALESMGFKTFGFAGGRADTWEPEDV
YWGSEKIWLELSGGPNSRYSGDRQLENPLAAVQMGLIYVNPEGPDGNPDPVAAARDIRDT
FARMAMNDEETVALIAGGHTFGKTHGAGPASNVGPEPEAAGLEEQGLGWKSAYGTGKGAD
AITSGLEVTWTKTPTQWSNNFFENLFGYEWELTKSPAGAHQWVAKDADAVIPDAFDPSKK
HRPTMLTTDLSLRFDPAYEKISRRFHEHPDEFADAFARAWFKLTHRDMGPRARYLGPEVP
AEELLWQDPIPAVDHPLIDAADVAALKAQVLASGLSVSQLVSTAWAAASTFRGSDKRGGA
NGARIRLAPQKDWEANQPEQLATVLATLEAIRRTFNGAQSGGKRVSLADLIVLAGCAGVE
QAAKNAGHAVTVPFAPGRMDASQEQTDVESMAVLEPLADGFRNYLKGKYRVPAEVLLVDK
AQLLTLSAPEMTVLLGGLRVLGANAGQSRHGVFTARAQALTNDFFVNLLDMSTEWKPASA
DADVFEGRDRATGALKWTGTRVDLVFGSHSQLRALAEVYASADAQEKFVRDFVAVWNKVM
NLDRFDLA
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgtcgaatgaagcgaagtgcccgttccatcacgccgcaggcaacggcacgtcgaaccgg
gactggtggcccgatcagctggacctgagcgccctgcatcggcactcgtcgctgtccgat
ccgatggacagggatttcaactacgcgcaagcgttcgagaagctcgacctcgcggcggtg
aagcgcgatctccacgcgttgatgaccacgtcgcaggactggtggccggccgatttcggc
cactacggcggcctgttcatccgcatggcgtggcatagcgcgggcacctaccgcacggcc
gacggccgaggcggcgcgggcgaagggcagcagcgcttcgcgccgctcaacagctggccc
gacaacgcgaacctcgacaaggcgcgccggctgctgtggccgatcaagcagaaatacggc
cgcagcatttcgtgggccgaccttctgatcctgacgggcaacgtcgcgctcgaatcgatg
ggcttcaagaccttcggcttcgcgggcggccgcgcggacacgtgggagcccgaggatgtc
tactggggctcggaaaagatctggctggagctgagcggcggcccgaacagccgctactcg
ggcgatcgccaactcgagaacccgctcgccgccgtgcagatgggcctcatctacgtgaat
cccgaaggcccggacggcaatcccgatccggtcgcggcggcgcgcgacattcgcgacacc
ttcgcgcgcatggcgatgaacgacgaagagacggtcgcgctgatcgcgggcggccatacg
ttcggcaagacccacggcgcggggcccgcgtcgaacgtcggccccgagccggaggccgcg
ggcctcgaggagcagggcctcggctggaagagcgcgtacggcacgggcaagggcgcggac
gcaatcacgagcggcctcgaggtcacgtggacgaagacgccgacgcagtggagcaacaac
ttcttcgagaacctgttcggctacgaatgggaactgacgaagagcccggcgggcgcgcac
cagtgggtcgcgaaggacgccgacgcggtgattccggacgcgttcgatccgtcgaagaag
catcggccgacgatgctgacgaccgacttgtcgctgcgcttcgatccggcgtacgagaag
atctcgcgccgcttccacgagcaccccgacgagttcgccgatgcgttcgcgcgcgcgtgg
ttcaagctcacccaccgcgacatgggcccgcgcgcgcgctatctcggcccggaagtgccg
gccgaggagctgttgtggcaggacccgattccggccgtcgaccatccgctgatcgacgcc
gccgacgtcgccgcgctgaaggcgcaggtgctcgcgtcggggctgtccgtgtcgcagctc
gtgtcgaccgcgtgggcggcggcgtccaccttccgcgggtcggacaagcgcggcggcgcg
aacggtgcgcgcattcgccttgcgccgcagaaggactgggaagcgaaccagcccgagcaa
ctcgcgacggtgctcgcgacgctcgaagcgatccgccggacgttcaacggcgcgcagtcg
ggcggcaagcgggtgtcgctcgccgatctgatcgtgctggccggctgcgccggcgtcgag
caggccgcgaagaacgcgggccacgcggtgacggtgccgttcgcgccgggccgcatggat
gcgtcgcaggagcagaccgacgtcgaatcgatggccgtgctcgagccgctcgcggacggc
ttccgcaactacctgaagggcaagtaccgggtgcccgccgaggtgctgctcgtcgacaag
gcgcaactgctgacgctgagcgcgccggagatgacggtgctgctgggcggcctgcgcgtg
ctgggcgcgaacgccgggcagagccggcacggcgtgttcaccgcgcgtgcgcaggcgctg
accaacgacttcttcgtgaacctgctcgacatgagcaccgagtggaagccggcgtcggcg
gacgcggacgtgttcgaagggcgcgaccgcgcgacgggcgcgctcaagtggacgggcacg
cgcgtcgatctcgtgttcggctcgcattcgcaactgcgcgcgctcgccgaggtctacgcc
agcgcggacgcgcaggagaagttcgtgcgcgatttcgtcgcggtctggaacaaggtgatg
aacctcgaccgcttcgacctcgcctga

DBGET integrated database retrieval system