KEGG   Burkholderia thailandensis E264: BTH_I1598
Entry
BTH_I1598         CDS       T00311                                 

Name
(GenBank) TonB-dependent receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bte02000]
    BTH_I1598
Transporters [BR:bte02000]
 Other transporters
  Pores ion channels [TC:1]
   BTH_I1598
SSDB
Motif
Pfam: TonB_dep_Rec Plug OMP_b-brl_3
Other DBs
NCBI-ProteinID: ABC36583
UniProt: Q2SY62
Position
I:1796067..1798403
AA seq 778 aa
MSHELAAHVARTRLAAACVAAFAWPAAHAVTTGAAVPADSTSAAAAETTASGKTLDIVRV
TAQRPAFASDTPGVVEALTREQIDSHVNVTTEDALKYAPNLMVRRRYIGDRNSVFAGRDF
NELQSARGLVYADGILLSNLLGSSYSYPPRWSLIQPDDIARVDVLYGPFSALYPGNAIGS
TVQITTRKPDRLEASVSTQFFTQRYRDGYGFADSFGGNHQTARVADRVGRFWYALSLDRL
ENDSQPMQYASPNGTFDPRLGASVPVTGAVSDIGPNGRPRTIVGAQTIERTEQLNETLRF
GYAFTDHVDATVTLGHWENHYRQHGDTFLRDAAGNPVYGGNVSFGGRSYTVSPTAFAPQT
GDQENWLYGLGLDARLASGWKLSATASAYEVSRDVLRSASGAPTGAWDGGPGTVFHGDGT
GWRTVDLRAESPDVRGHRFSFGYHFDTYFLRNATYNTADWQNAVPTTLANRYRGNTRTQA
LYAQDAWRFAPGWLATLGLRYERWDAYGGQLGNANATLGYAGRGATALSPKLALEWQPTD
AWRLRLSFATGTRFPTVAELFQGTISNNAIVNNNPNLQPEKAIDWDFTAERDVGFGVVRT
SVFQSDLRNSIYSQTTVAGASTYTNISNVDRVRVRGVELAFSGQDVAIKGLDVDANVSAT
NAQTLADAANPNYVGARWPRIPRMRANLLASYRFGEHWMTSVGVRYSGRQYNALDNSDVN
PNVYGGTSSFAVVDLKARYRFDRHWLASFGIDNVTDRRYYVFHPYPGRTFYGELKWSL
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgtcccatgaacttgccgcgcacgtcgcgcgcacgcggctcgcggccgcctgcgtcgcg
gcgttcgcctggcccgccgcgcacgccgtcacgacgggcgccgccgtccctgccgattca
acgtccgccgccgctgccgagacgaccgcatccgggaaaaccctggatatcgtcagggtg
accgcgcagcgccccgcattcgcgtccgacacgcccggcgtcgtcgaggcgctcacgcgc
gagcagatcgattcgcacgtcaacgtgacgaccgaagacgcgctcaagtacgcgccgaac
ctgatggtgcgccggcgctatatcggcgatcgcaactccgtgttcgccggccgcgatttc
aacgagttgcagagcgcgcgcggactcgtttacgcggacggcatcctcctgtcgaatctg
ctcggctccagttactcgtatccgccgcgttggtcgctgatccagcccgacgacatcgcg
cgcgtcgacgtgctgtacggcccgttctccgcgctctacccgggcaatgcgatcggctcg
accgtgcagatcacgacgcgcaagccggatcggctcgaggcgtcggtgtcgacgcagttc
ttcacgcagcgctatcgcgacggctacggctttgccgacagcttcggcggcaatcaccag
accgcgcgcgtcgccgaccgcgtcgggcgcttctggtatgcgctgtcgctcgaccggctc
gagaacgacagccagccgatgcaatacgcgagcccgaatggcacgttcgatccgcggctc
ggcgcgagcgtgccggtgacgggcgccgtttccgacatcggcccgaacggccggcctcgg
acgatcgtcggcgcgcagacgatcgagcgcaccgagcagctcaacgagacgctgcgcttc
ggctatgcgttcaccgaccacgtcgatgcgacggttacgctcggccactgggagaatcac
taccggcagcacggcgacacgttcctgcgcgacgcggcgggcaacccggtatacggcggc
aacgtgtcgttcggcgggcgcagctacacggtgtcgccgaccgcgttcgcgccgcagacc
ggcgaccaggagaactggctgtacgggctcgggctcgacgcgcgtctcgcatcaggctgg
aagctgtcggcgaccgcgtccgcgtacgaggtgtcgcgcgacgtgctgcgcagcgcgtcc
ggcgcgccgaccggcgcgtgggacggcggcccgggcacggtattccatggcgacggcacc
ggctggcgcaccgtcgatttgcgagcggagtcgcccgacgtgcgcgggcaccgcttctcg
ttcggctatcacttcgacacctatttcctgcgcaacgcgacctacaacacggcggactgg
caaaacgccgtgccgacgacgcttgcgaaccgttatcgcggcaacacgcgcacgcaggcg
ctgtacgcgcaagacgcgtggcgtttcgcgcccggctggctcgcgacgctcggcctgcgc
tacgaacgatgggatgcatacggcggccagctcggcaacgcgaacgcgacgctcggctac
gccggccgtggcgcgaccgcgctgtcgccgaagctcgcgctcgaatggcagccaacggac
gcatggcgcctgcggctgtcgttcgcgacgggcacgcgctttccgaccgtggccgaactg
ttccagggcacgatctcgaacaacgcgatcgtcaacaacaacccgaacctgcaaccggaa
aaggcgatcgactgggacttcacggccgagcgcgacgtcggcttcggcgtcgtgcgcacg
agcgtgttccagagcgatctgcgcaattcgatctacagccagacgacggtcgcgggcgct
tcgacgtacacgaacatctcgaacgtcgaccgcgtgcgggtgcgcggcgtcgaactcgcg
ttttcagggcaggacgtcgcgatcaaggggctcgacgttgacgcgaacgtgtccgcgacg
aatgcgcagacgctcgccgatgcggcgaatccgaactacgtcggcgcgcgttggccgcgg
attccacggatgcgcgcgaacttgctcgcgtcgtaccgcttcggcgagcactggatgacg
agcgtcggcgtgcgctattcggggcggcagtacaacgcgctcgacaacagcgacgtgaac
ccgaacgtgtacggcggcaccagttcgtttgcggtcgtcgacctcaaggcgcgctaccgg
ttcgatcggcactggctcgcgtcgttcggcatcgacaacgtgaccgatcgccgctactac
gtgtttcacccttatccaggccgcactttttatggagagttgaaatggtcgctgtga

DBGET integrated database retrieval system