KEGG   Burkholderia thailandensis E264: BTH_I1644Help
Entry
BTH_I1644         CDS       T00311                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00540  Lipopolysaccharide biosynthesis
bte01100  Metabolic pathways
Module
bte_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BTH_I1644 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bte01005]
    BTH_I1644 (rfaD)
Enzymes [BR:bte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BTH_I1644 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:bte01005]
 Unusual sugar
  BTH_I1644 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: ABC38509
UniProt: Q2SY18
Structure
PDB: 

Position
I:1853351..1854343
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGANLVKALNERGETRIIAVDNLTRADKFKNLVDCEIDDYLDKTEFVER
FARGDFGKVRAVFHEGACSDTMETDGRYMMDNNFRYSRAVLDACLAQGAQFLYASSAAIY
GGSSRFVEEREVEAPLNVYGYSKFLFDQVIRRVMPGAKSQIAGFRYFNVYGPRESHKGRM
ASVAFHNFNQFRAEGKVKLFGEYSGYGPGEQTRDFVSVEDVAKVNLYFFDHPEKSGIFNL
GTGRAQPFNDIAATVVNTLRALEGQPALTLAEQVEQGLVEYVPFPDALRGKYQCFTQADQ
TKLRAAGYDAPFLTVQEGVDRYVRWLFGQL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgttaccggcgcggccggcttcatcggcgcgaacctcgtcaaggcgctg
aacgagcgcggcgagacgcgcatcatcgcggtcgacaacctgacgcgcgcggacaagttc
aagaatctcgtcgattgcgagatcgacgactatctcgacaagaccgaattcgtcgagcgc
ttcgcacgcggcgatttcggcaaggtgcgcgcggtgttccacgaaggcgcctgctcggac
acgatggaaaccgacggccgctacatgatggacaacaacttccgctacagccgcgcggtg
cttgatgcgtgcctcgcgcagggcgcgcagttcctgtatgcgtcgtcggccgcgatctac
ggcggctcgagccgcttcgtcgaggagcgcgaggtcgaggcgccgctcaacgtgtacggc
tattcgaagttcctgttcgatcaggtgatccgccgcgtgatgccgggcgcgaaaagccag
atcgcgggctttcgctacttcaacgtgtacgggccgcgcgagtcgcacaaagggcgcatg
gcgtcggtcgcgttccacaacttcaaccagttccgcgccgagggcaaggtcaagctgttc
ggcgagtacagcggctatggcccgggcgagcagacgcgcgatttcgtgtcggtcgaggac
gtcgcgaaggtgaacctgtatttcttcgatcatccggagaaatcgggcattttcaatctc
ggcaccggtcgcgcacagccgttcaacgacatcgcggcgacggtcgtcaacacgctgcgc
gcgctcgaaggccagccggcgctcacgcttgccgagcaggtcgagcaggggctcgtcgaa
tacgtgccgttcccggacgcgctgcgcggcaagtaccagtgcttcacgcaggccgaccag
acgaagctgcgcgcggccggctacgatgcgccgttcctgacggtgcaggaaggcgtcgat
cgctacgttcgttggctgttcggccagctgtaa

DBGET integrated database retrieval system