KEGG   Burkholderia thailandensis E264: BTH_I1656
Entry
BTH_I1656         CDS       T00311                                 

Definition
(GenBank) D-amino acid dehydrogenase, small subunit
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00360  Phenylalanine metabolism
bte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BTH_I1656
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     BTH_I1656
SSDB
Motif
Pfam: DAO Pyr_redox Pyr_redox_2 NAD_binding_8 FAD_binding_2 HI0933_like ApbA Amino_oxidase UDPG_MGDP_dh_N FAD_binding_3 3HCDH_N AlaDh_PNT_C Trp_halogenase Thi4 NAD_binding_7 GIDA FAD_oxidored Glyco_transf_4 XdhC_C NAD_Gly3P_dh_N Rossmann-like Sacchrp_dh_NADP ThiF DUF5693
Other DBs
NCBI-ProteinID: ABC37282
UniProt: Q2SY06
Position
I:complement(1866384..1867670)
AA seq 428 aa
MRVVILGSGVVGVASAYYLARAGHEVTVIDREAGPALDTSFANAGQISPGYAAPWAAPGV
PLKAVKWMFEKHAPLAIRLDGTRFQLQWMWQMLRNCTTERYALNKGRMVRLAEYSRDCLQ
ALRAETDIQYEGRTGGTLQVFRTQQQLDGAAKDIAVLREANVPFELLSSDELKKAEPALA
AVSHKLTGGLRLPGDETGDCQLFTTRLAALAEQLGVKFRFNTRIDALAVAGGKIAGVQCG
GEMVRADAYVVALGAFSTNLVANLVKIPVYPLKGYSITAPIVDAAKAPVSTVLDETYKIA
ITRFDERIRVGGMAEIVGFDKRLRQARRDTLEMCVNDLFPGGGDTANASFWTGLRPMTPD
GTPIVGRTPVPNLFLNTGHGTLGWTMSCGSGQLLADLMSGKKPAIRADDLSVHRYLSETD
GEHRPAYA
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgcgtgtggttattttgggcagtggcgtggttggcgtggcaagcgcctattatctggcg
cgcgcgggccatgaagtcacggtgatcgaccgcgaggccggccccgcccttgacacgagc
tttgcgaacgcgggccagatctcgcccggctacgcggcgccgtgggccgcgcccggcgtg
ccgctgaaggccgtcaagtggatgttcgagaagcacgcgccgctcgcgatccgcctcgac
ggcacgcgcttccaactgcaatggatgtggcagatgctgcgcaactgcacgaccgagcgc
tatgcgctgaacaagggccggatggtgcgccttgccgaatacagccgcgattgcctgcag
gcgctgcgcgcggagacggacatccagtatgaaggccgcacgggcggcacgctgcaggtc
ttccgcacgcagcagcaactcgacggcgccgcgaaggacatcgccgtgctgcgggaagcg
aacgtgccgttcgagctgctgtcgagcgacgaactgaagaaagccgagccggcgctcgcc
gcggtgtcgcacaagttgacgggcggcctgcgcctgccgggcgacgaaacgggcgactgc
cagctcttcacgacgcgtctcgccgcgctcgccgagcagctcggcgtgaagttccgcttc
aacacgcgcatcgatgcgctcgccgtcgcgggcggcaagatcgcgggcgtccagtgcggc
ggcgaaatggtgcgcgccgacgcctacgtggtcgcgctcggcgcgttctcgacgaacctc
gtcgcgaatctcgtgaagattccggtgtatccgctgaaaggctattcgatcaccgcgccg
atcgtcgacgcggcgaaagcgcccgtgtcgaccgtgctcgacgagacctacaagatcgcg
atcacgcgtttcgacgagcggattcgcgtcggcggaatggcggagatcgtcggcttcgac
aagcgactgcgccaggcgcgccgcgacacgctcgaaatgtgcgtgaacgacctgttcccg
ggcggcggcgacacggcgaacgcgtcgttctggaccggcctgcggccgatgacgccggac
ggcacgccgatcgtcggccgcacgcccgtgccgaatctgttcctgaacacgggccacggc
acgctcggctggacgatgtcgtgcggctccggccagttgctcgccgatctgatgtccggc
aagaagcccgcgatccgcgcggacgatctgtcggtgcatcgctacctgagcgagacggac
ggcgagcatcgccccgcgtacgcatga

DBGET integrated database retrieval system