KEGG   Burkholderia thailandensis E264: BTH_I2185Help
Entry
BTH_I2185         CDS       T00311                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BTH_I2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABC39280
UniProt: Q2SWJ3
Position
I:2457988..2459052
Genome map
AA seq 354 aa AA seqDB search
MSRTSSKASCWKTPERTTMHSIQLALWVVAALVLVALVFDFMNGFHDAANSIATVVSTGV
LKPQQAVVFAAAFNVIAYFIFHLKVAQTVGKGTIDASIVDHYVVFGALFGAIGWNIITWY
YGIPSSSSHALIGGLVGAAVSKSGWGSLNVDGLMKTVAFIFISPLLGFILGSLFMLGVSW
LYFRTAPSKVDRRFRRLQLLSASLYSLGHGGNDAQKTIGIIWMLLIASGYASAASDAPPA
WVIGACYLSMGLGTLFGGWRIVRTMGQKITKLKPVGGFCAETGGALTLFIASWMGIPVST
THTITGAIVGVGATRKLSAVRWGVAGNIVWAWVLTIPASALIAAAGWWIGHRVF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaacatcatcgaaggcatcgtgctggaaaacgcctgagcggaccacgatgcat
tcgatacaactcgccttgtgggtcgtcgcggcactcgtgcttgtcgcgctcgtgttcgat
ttcatgaacggctttcacgacgccgcgaactcgatcgcgaccgtcgtgtcgaccggggtg
ctgaagccccagcaagccgtcgtgttcgcggcggcattcaacgtcatcgcgtatttcatc
ttccatctgaaagttgcgcagaccgtcggcaagggcacgatcgacgcgagcatcgtcgat
cactacgtcgtgttcggcgcgctgttcggtgcgatcggctggaacatcattacgtggtac
tacgggattccgtcgagctcgtcgcacgcgctgatcggcgggctcgtcggcgccgcggtg
tcgaagtcgggctggggatcgctcaacgtcgacgggctgatgaagacggtcgcattcatc
ttcatctcgccgcttctcggcttcatcctcggatcgctgttcatgctcggggtatcgtgg
ctgtacttccggaccgcgccaagcaaggtcgaccggcgtttcaggcggctgcaactgttg
tcggccagcctctacagcctcggccacggcggcaacgacgcgcagaagacaatcggcatc
atttggatgctgctgatcgcgtccgggtacgcatcggccgcctccgacgcgccgcctgcg
tgggtgatcggcgcgtgctatctgtcgatgggcctcggcacgttgttcggcggttggcgg
atcgtgcgcacgatgggtcagaagatcacgaagctcaagcccgtgggcggcttctgcgcg
gagacaggcggcgcgctcactctgttcatcgcgtcgtggatgggtatcccggtgtcgacc
acgcatacgatcacgggtgcgatcgtcggcgtcggcgcgacgcgcaagctgtcggccgta
cggtggggcgtcgcaggcaacatcgtgtgggcatgggtgctgacgattcccgcatcggca
ttgatcgcggcggccgggtggtggatcgggcaccgcgtgttctga

DBGET integrated database retrieval system