KEGG   Burkholderia thailandensis E264: BTH_I2245Help
Entry
BTH_I2245         CDS       T00311                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00230  Purine metabolism
bte00250  Alanine, aspartate and glutamate metabolism
bte01100  Metabolic pathways
Module
bte_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BTH_I2245 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTH_I2245 (purA)
Enzymes [BR:bte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BTH_I2245 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ABC37654
UniProt: Q2SWD3
Structure
PDB: 

Position
I:2522753..2524099
Genome map
AA seq 448 aa AA seqDB search
MSASAVNVTPGRNVVVVGTQWGDEGKGKIVDWLTDHAQGVVRFQGGHNAGHTLIIGGKKT
ILRLIPSGIMREGVACYIGNGVVLSPEALFKEIGELEEAGLSVRERLFISEATTLILPYH
IAIDQAREARKGAGKIGTTGRGIGPAYEDKVGRRALRVQDLFDARTFADRLRENLDFHNF
VLTQYLGGAAVDFQATLDTMLGYADRLRPMVADVSRRLYEENHAGRNLLFEGAQGTLLDI
DHGTYPFVTSSNCVAGAAAAGAGVGPQKLNYILGITKAYCTRVGSGPFPSELYDADNPSR
QDQIGITLANVGKEFGSVTGRPRRTGWLDAAALRRSIQINGVSGLCMTKLDVLDGLDEVK
LCVGYKIDGEDADLLPRGAAEVARCEPVYETFGGWKESTVGINSWDALPANARAYLTRVQ
EVAGVPIDMVSTGPDRDETILLRHPFKV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccagcgcagtgaacgtgactcccgggcgcaacgtcgtcgtcgtggggactcaa
tggggtgatgaaggcaaaggcaagatcgtcgactggctgacggaccacgctcagggcgtc
gtgcgtttccagggcggccacaacgccggccacaccctcatcatcggcggcaagaagacc
atcttgcgcctcatcccgtcgggcatcatgcgcgaaggcgtcgcctgctacatcggcaac
ggtgtcgtcctgtcccccgaggcactgttcaaggaaatcggcgagctggaagaggccggc
ctttccgttcgtgagcgcctgttcatttccgaagcgacgacgctgatccttccgtatcac
atcgcgatcgaccaggcgcgcgaagcgcgcaagggcgcgggcaagatcggcacgacgggc
cgcggcatcggccccgcgtatgaggacaaggtcggccgtcgcgcgctgcgcgtgcaggac
ctgttcgacgcgcgaacgttcgccgatcgcctgcgcgagaatctcgacttccacaatttc
gtgctgacgcagtatctcggcggcgcggccgtcgatttccaggcgacgctcgacacgatg
ctcggctacgcggatcgcctgaggccgatggtcgcggacgtgtcgcgccgtctgtacgaa
gaaaaccacgcgggccgcaacctgctgttcgaaggcgcgcagggcacgctgctcgatatc
gatcacggcacctatccgttcgtcacgtcgagcaactgcgtcgcgggcgcggcggcggcg
ggcgcgggcgtcggcccgcagaagcttaactacatcctcggcatcacgaaggcgtattgc
acgcgcgtcggctcggggccgttcccgagcgagttgtacgacgcggacaatccgagtcgc
caggatcagatcggcatcacgctcgcgaacgtcggcaaggaattcggctccgtcacgggc
cgtccgcgccgcaccggctggctcgacgcggccgcgcttcgccgctcgattcagatcaac
ggcgtgtcgggcctttgcatgacgaaactcgacgtgctcgacggcctcgacgaagtgaag
ctgtgcgtcggctacaagatcgacggcgaagatgctgatctgctgccgcgcggcgcggct
gaagtcgcgcgctgcgagcccgtctacgagacgttcgggggctggaaggaaagcacggtc
ggcatcaattcgtgggacgcgctgcccgcgaacgcgcgtgcgtatctgacgcgcgtgcag
gaagtggccggcgtgccgatcgacatggtgtccaccggcccggatcgcgacgagacgatc
ctgctgcgtcatccgttcaaggtgtaa

DBGET integrated database retrieval system